Western Blot (WB)
(WB Suggested Anti-UNQ1887 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Rabbit UNQ1887 Polyclonal Antibody | anti-SPPL3 antibody
UNQ1887 antibody - middle region
Gene Names
SPPL3; IMP2; PSH1; PSL4; PRO4332; MDHV1887
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UNQ1887; Polyclonal Antibody; UNQ1887 antibody - middle region; anti-SPPL3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF
Sequence Length
384
Applicable Applications for anti-SPPL3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UNQ1887
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-UNQ1887 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Western Blot (WB)
(WB Suggested Anti-UNQ1887 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: A549 cell lysate)
Related Product Information for anti-SPPL3 antibody
This is a rabbit polyclonal antibody against UNQ1887. It was validated on Western Blot
Target Description: UNQ1887 may act as intramembrane protease.
Target Description: UNQ1887 may act as intramembrane protease.
Product Categories/Family for anti-SPPL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42kDa
NCBI Official Full Name
signal peptide peptidase-like 3
NCBI Official Synonym Full Names
signal peptide peptidase like 3
NCBI Official Symbol
SPPL3
NCBI Official Synonym Symbols
IMP2; PSH1; PSL4; PRO4332; MDHV1887
NCBI Protein Information
signal peptide peptidase-like 3
UniProt Protein Name
Signal peptide peptidase 3
Protein Family
UniProt Gene Name
SPPL3
UniProt Synonym Gene Names
UNQ1887
UniProt Entry Name
Q3MJ04_HUMAN
Uniprot Description
SPPL3: Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane. Belongs to the peptidase A22B family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; EC 3.4.23.-; Protease; Membrane protein, integral
Chromosomal Location of Human Ortholog: 12q24.31
Cellular Component: rough endoplasmic reticulum
Molecular Function: protein homodimerization activity; aspartic endopeptidase activity, intramembrane cleaving
Biological Process: membrane protein ectodomain proteolysis
Research Articles on SPPL3
Similar Products
Product Notes
The SPPL3 sppl3 (Catalog #AAA3210912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UNQ1887 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UNQ1887 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPPL3 sppl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMVKVATQPA DNPLDVLSRK LHLGPNVGRD VPRLSLPGKL VFPSSTGSHF. It is sometimes possible for the material contained within the vial of "UNQ1887, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
