Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATF6Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ATF6 Polyclonal Antibody | anti-ATF6 antibody

ATF6 Antibody - N-terminal region

Gene Names
ATF6; ACHM7; ATF6A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATF6; Polyclonal Antibody; ATF6 Antibody - N-terminal region; anti-ATF6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLM
Sequence Length
670
Applicable Applications for anti-ATF6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATF6Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATF6Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATF6 antibody
This gene encodes a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. It functions as an ER stress sensor/transducer, and following ER stress-induced proteolysis, it functions as a nuclear transcription factor via a cis-acting ER stress response element (ERSE) that is present in the promoters of genes encoding ER chaperones. This protein has been identified as a survival factor for quiescent but not proliferative squamous carcinoma cells. There have been conflicting reports about the association of polymorphisms in this gene with diabetes in different populations, but another polymorphism has been associated with increased plasma cholesterol levels. This gene is also thought to be a potential therapeutic target for cystic fibrosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75 kDa
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-6 alpha
NCBI Official Synonym Full Names
activating transcription factor 6
NCBI Official Symbol
ATF6
NCBI Official Synonym Symbols
ACHM7; ATF6A
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-6 alpha
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-6 alpha
UniProt Gene Name
ATF6
UniProt Synonym Gene Names
cAMP-dependent transcription factor ATF-6 alpha; ATF6-alpha
UniProt Entry Name
ATF6A_HUMAN

NCBI Description

This gene encodes a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. It functions as an ER stress sensor/transducer, and following ER stress-induced proteolysis, it functions as a nuclear transcription factor via a cis-acting ER stress response element (ERSE) that is present in the promoters of genes encoding ER chaperones. This protein has been identified as a survival factor for quiescent but not proliferative squamous carcinoma cells. There have been conflicting reports about the association of polymorphisms in this gene with diabetes in different populations, but another polymorphism has been associated with increased plasma cholesterol levels. This gene is also thought to be a potential therapeutic target for cystic fibrosis. [provided by RefSeq, Aug 2011]

Uniprot Description

ATF6A: Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor. Belongs to the bZIP family. ATF subfamily.

Protein type: Transcription factor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: Golgi membrane; nucleoplasm; Golgi apparatus; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to endoplasmic reticulum membrane; nuclear envelope; nucleus

Molecular Function: protein binding; protein heterodimerization activity; transcription coactivator activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; transcription, DNA-dependent; protein folding; unfolded protein response; positive regulation of transcription of target genes involved in unfolded protein response; response to stress; signal transduction

Disease: Achromatopsia 7

Research Articles on ATF6

Similar Products

Product Notes

The ATF6 atf6 (Catalog #AAA3224206) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATF6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATF6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF6 atf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLFHRLDEDW DSALFAELGY FTDTDELQLE AANETYENNF DNLDFDLDLM. It is sometimes possible for the material contained within the vial of "ATF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.