Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ASF1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ASF1A Polyclonal Antibody | anti-ASF1A antibody

ASF1A Antibody - C-terminal region

Gene Names
ASF1A; CIA; CGI-98; HSPC146
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ASF1A; Polyclonal Antibody; ASF1A Antibody - C-terminal region; anti-ASF1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSE
Sequence Length
204
Applicable Applications for anti-ASF1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ASF1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ASF1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASF1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ASF1A antibody
This is a rabbit polyclonal antibody against ASF1A. It was validated on Western Blot

Target Description: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair.
Product Categories/Family for anti-ASF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
histone chaperone ASF1A
NCBI Official Synonym Full Names
anti-silencing function 1A histone chaperone
NCBI Official Symbol
ASF1A
NCBI Official Synonym Symbols
CIA; CGI-98; HSPC146
NCBI Protein Information
histone chaperone ASF1A
UniProt Protein Name
Histone chaperone ASF1A
Protein Family
UniProt Gene Name
ASF1A
UniProt Synonym Gene Names
hAsf1; hAsf1a; CIA; hCIA
UniProt Entry Name
ASF1A_HUMAN

NCBI Description

This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair. [provided by RefSeq, Jul 2008]

Uniprot Description

ASF1A: Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit. Interacts with histone H3 (including both histone H3.1 and H3.3) and histone H4. Interacts with the CHAF1A, CHAF1B and RBBP4 subunits of the CAF-1 complex. Interacts with CABIN1, HAT1, HIRA, NASP, TAF1, TLK1, TLK2 and UBN1. Ubiquitously expressed. Belongs to the ASF1 family.

Protein type: DNA repair, damage; Histone-binding

Chromosomal Location of Human Ortholog: 6q22.31

Cellular Component: nucleoplasm; protein complex; nuclear chromatin; nucleus

Molecular Function: protein binding; histone binding; chromatin binding

Biological Process: osteoblast differentiation; nucleosome assembly; muscle cell differentiation; transcription, DNA-dependent; negative regulation of chromatin silencing; DNA replication-independent nucleosome assembly; chromatin modification; DNA repair; DNA replication-dependent nucleosome assembly

Research Articles on ASF1A

Similar Products

Product Notes

The ASF1A asf1a (Catalog #AAA3219661) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASF1A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASF1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASF1A asf1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASNPRVTRFH INWEDNTEKL EDAESSNPNL QSLLSTDALP SASKGWSTSE. It is sometimes possible for the material contained within the vial of "ASF1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.