Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARR3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit anti-Human ARR3 Polyclonal Antibody | anti-ARR3 antibody

ARR3 antibody - C-terminal region

Gene Names
ARR3; ARRX; cArr; MYP26
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARR3; Polyclonal Antibody; ARR3 antibody - C-terminal region; anti-ARR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS
Sequence Length
388
Applicable Applications for anti-ARR3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ARR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARR3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-ARR3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-ARR3 antibody
This is a rabbit polyclonal antibody against ARR3. It was validated on Western Blot

Target Description: ARR3 may play a role in an as yet undefined retina-specific signal transduction. 'ARR3 could binds to photoactivated-phosphorylated red/green opsins.
Product Categories/Family for anti-ARR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
407
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
arrestin-C
NCBI Official Synonym Full Names
arrestin 3
NCBI Official Symbol
ARR3
NCBI Official Synonym Symbols
ARRX; cArr; MYP26
NCBI Protein Information
arrestin-C
UniProt Protein Name
Arrestin-C
Protein Family
UniProt Gene Name
ARR3
UniProt Synonym Gene Names
ARRX; CAR; C-arrestin; cArr
UniProt Entry Name
ARRC_HUMAN

NCBI Description

The protein encoded by this gene is a non-visual arrestin which binds to agonist-activated, phosphorylated G protein-coupled receptors. This binding uncouples the receptor from the heterotrimeric G protein, resulting in termination of the G protein-coupled receptor signaling. The encoded protein also is a part of the centrosome, interacting with gamma-tubulin to help regulate proper centrosome function. [provided by RefSeq, May 2016]

Uniprot Description

ARR3: May play a role in an as yet undefined retina-specific signal transduction. Could binds to photoactivated-phosphorylated red/green opsins. Belongs to the arrestin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: Xcen-q21

Cellular Component: photoreceptor inner segment; photoreceptor outer segment; cytoplasm; synapse

Molecular Function: protein binding; opsin binding; phosphoprotein binding

Biological Process: regulation of protein amino acid phosphorylation; visual perception; endocytosis; signal transduction

Research Articles on ARR3

Similar Products

Product Notes

The ARR3 arr3 (Catalog #AAA3214484) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARR3 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARR3 arr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVGVELPLVL IHPKPSHEAA SSEDIVIEEF TRKGEEESQK AVEAEGDEGS. It is sometimes possible for the material contained within the vial of "ARR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.