Western Blot (WB)
(Western blot analysis of extracts of mouse thymus, using ARL6IP5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Rabbit anti-Mouse ARL6IP5 Polyclonal Antibody | anti-ARL6IP5 antibody
ARL6IP5 Polyclonal Antibody
Gene Names
ARL6IP5; JWA; jmx; hp22; PRAF3; Yip6b; DERP11; HSPC127; addicsin; GTRAP3-18
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ARL6IP5; Polyclonal Antibody; ARL6IP5 Polyclonal Antibody; addicsin; DERP11; GTRAP3-18; hp22; HSPC127; jmx; JWA; PRAF3; Yip6b; anti-ARL6IP5 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
TFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Sequence Length
188
Applicable Applications for anti-ARL6IP5 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human ARL6IP5.
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of mouse thymus, using ARL6IP5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of mouse thymus, using ARL6IP5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-ARL6IP5 antibody
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.
Product Categories/Family for anti-ARL6IP5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 21kDa
Observed: 22kDa
Observed: 22kDa
NCBI Official Full Name
PRA1 family protein 3
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 6 interacting protein 5
NCBI Official Symbol
ARL6IP5
NCBI Official Synonym Symbols
JWA; jmx; hp22; PRAF3; Yip6b; DERP11; HSPC127; addicsin; GTRAP3-18
NCBI Protein Information
PRA1 family protein 3
UniProt Protein Name
PRA1 family protein 3
Protein Family
UniProt Gene Name
ARL6IP5
UniProt Synonym Gene Names
DERP11; JWA; PRA2; PRAF3; ARL-6-interacting protein 5; Aip-5
NCBI Description
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq, Jul 2008]
Uniprot Description
Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. May be involved in membrane traffic.
Research Articles on ARL6IP5
Similar Products
Product Notes
The ARL6IP5 arl6ip5 (Catalog #AAA9134834) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL6IP5 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARL6IP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ARL6IP5 arl6ip5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TFVMVVMLAS YFLISMFGGV MVFVFGITFP LLLMFIHASL RLRNLKNKLE NKMEGIGLKR TPMGIVLDAL EQQEEGINRL TDYISKVKE. It is sometimes possible for the material contained within the vial of "ARL6IP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
