Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Arl2bp AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)

Rabbit Arl2bp Polyclonal Antibody | anti-ARL2BP antibody

Arl2bp antibody - C-terminal region

Gene Names
Arl2bp; BART; Bart1; AI482273; AI849834; 1700010P10Rik; 1700027H16Rik; 6330544B05Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Arl2bp; Polyclonal Antibody; Arl2bp antibody - C-terminal region; anti-ARL2BP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVT
Sequence Length
152
Applicable Applications for anti-ARL2BP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Arl2bp AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)

Western Blot (WB) (WB Suggested Anti-Arl2bp AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Related Product Information for anti-ARL2BP antibody
This is a rabbit polyclonal antibody against Arl2bp. It was validated on Western Blot

Target Description: Together with ARL2, Arl2bp plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Arl2bp may play a role as an effector of ARL2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
ADP-ribosylation factor-like protein 2-binding protein isoform 2
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 2 binding protein
NCBI Official Symbol
Arl2bp
NCBI Official Synonym Symbols
BART; Bart1; AI482273; AI849834; 1700010P10Rik; 1700027H16Rik; 6330544B05Rik
NCBI Protein Information
ADP-ribosylation factor-like protein 2-binding protein
UniProt Protein Name
ADP-ribosylation factor-like protein 2-binding protein
UniProt Gene Name
Arl2bp
UniProt Synonym Gene Names
Bart; Bart1; ARF-like 2-binding protein
UniProt Entry Name
AR2BP_MOUSE

Research Articles on ARL2BP

Similar Products

Product Notes

The ARL2BP arl2bp (Catalog #AAA3215528) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Arl2bp antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Arl2bp can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARL2BP arl2bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQHHKDEVAG DIFDMLLTFT DFLAFKEMFL DYRAEKEGRG LDLSSGLVVT. It is sometimes possible for the material contained within the vial of "Arl2bp, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.