Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARHGEF1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellARHGEF1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit ARHGEF1 Polyclonal Antibody | anti-ARHGEF1 antibody

ARHGEF1 Antibody - N-terminal region

Gene Names
ARHGEF1; LSC; GEF1; LBCL2; SUB1.5; P115-RHOGEF
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARHGEF1; Polyclonal Antibody; ARHGEF1 Antibody - N-terminal region; anti-ARHGEF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG
Sequence Length
912
Applicable Applications for anti-ARHGEF1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGEF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARHGEF1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellARHGEF1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-ARHGEF1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellARHGEF1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-ARHGEF1 antibody
This is a rabbit polyclonal antibody against ARHGEF1. It was validated on Western Blot

Target Description: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Product Categories/Family for anti-ARHGEF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 1 isoform 1
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 1
NCBI Official Symbol
ARHGEF1
NCBI Official Synonym Symbols
LSC; GEF1; LBCL2; SUB1.5; P115-RHOGEF
NCBI Protein Information
rho guanine nucleotide exchange factor 1
UniProt Protein Name
Rho guanine nucleotide exchange factor 1
UniProt Gene Name
ARHGEF1
UniProt Synonym Gene Names
p115-RhoGEF; p115RhoGEF
UniProt Entry Name
ARHG1_HUMAN

NCBI Description

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]

Uniprot Description

ARHGEF1: Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2- induced RhoA activation. Interacts with RHOA, GNA12 and GNA13. Homooligomerizes through the coiled coil region. May interact with CCPG1. Interacts with CTNNAL1. Ubiquitously expressed. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs, Rac/Rho; GEFs; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.13

Cellular Component: cytoplasm; plasma membrane; cytosol

Molecular Function: Rho guanyl-nucleotide exchange factor activity; protein binding; GTPase activator activity

Biological Process: cell proliferation; nerve growth factor receptor signaling pathway; negative regulation of axonogenesis; regulation of axonogenesis; Rho protein signal transduction

Research Articles on ARHGEF1

Similar Products

Product Notes

The ARHGEF1 arhgef1 (Catalog #AAA3215962) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF1 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGEF1 arhgef1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAAVVNAIGL YMRHLGVRTK SGDKKSGRNF FRKKVMGNRR SDEPAKTKKG. It is sometimes possible for the material contained within the vial of "ARHGEF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.