Rabbit anti-Human, Mouse ARHGDIA Polyclonal Antibody | anti-ARHGDIA antibody

ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1) (HRP)

Cat. Num. AAA6370258

• Gene Names: ARHGDIA; GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARHGDIA; Polyclonal Antibody; ARHGDIA (Rho GDP-dissociation Inhibitor 1; Rho GDI 1; Rho-GDI alpha; GDIA1) (HRP); anti-ARHGDIA antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ARHGDIA. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-ARHGDIA antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ARHGDIA, aa1-204 (NP_004300.1).
• Immunogen Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ARHGDIA rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in human kidney.)

Western Blot (WB)

(ARHGDIA rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in mouse spleen.)

Western Blot (WB)

(ARHGDIA rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of ARHGDIA expression in transfected 293T cell line by ARHGDIA polyclonal antibody. Lane 1: ARHGDIA transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ARHGDIA antibody

Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Product Categories/Family for anti-ARHGDIA antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 297374783
• NCBI GeneID: 396
• NCBI Accession #: NP_004300.1
• NCBI GenBank Nucleotide #: NM_004309
• UniProt Accession #: P52565; Q6IBM5; A8MXW0; B2R5X1; B4DDD3; B4DUV9
• Molecular Weight: 18,233 Da
• NCBI Official Full Name: Homo sapiens Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: Rho GDP dissociation inhibitor (GDI) alpha
• NCBI Official Symbol: ARHGDIA
• NCBI Official Synonym Symbols: GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
• NCBI Protein Information: rho GDP-dissociation inhibitor 1; GDP-dissociation inhibitor, aplysia RAS-related 1; epididymis secretory sperm binding protein Li 47e
• UniProt Protein Name: Rho GDP-dissociation inhibitor 1
• UniProt Gene Name: ARHGDIA
• UniProt Synonym Gene Names: GDIA1; Rho GDI 1
• UniProt Entry Name: GDIR1_HUMAN

NCBI Description

This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

RhoGDI alpha: Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Monomer. Forms a heterodimer with RAC1. Interacts with FER. Belongs to the Rho GDI family.

Protein type: Cell adhesion; G protein regulator, misc.; Apoptosis; Cell development/differentiation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: cytoskeleton; immunological synapse; cytosol

Molecular Function: protein binding; Rho GDP-dissociation inhibitor activity; GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; regulation of protein localization; nerve growth factor receptor signaling pathway; small GTPase mediated signal transduction; negative regulation of axonogenesis; positive regulation of axonogenesis; negative regulation of cell adhesion; cell motility; regulation of axonogenesis; negative regulation of cell migration; Rho protein signal transduction; negative regulation of apoptosis; positive regulation of GTPase activity

Disease: Nephrotic Syndrome, Type 8