Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AREG blocking peptide

AREG Peptide - middle region

Gene Names
AREG; AR; SDGF; AREGB; CRDGF
Reactivity
Human
Predicted Reactivity: Cow, Dog, Horse, Human, Pig, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AREG; Polyclonal Blocking Peptide; AREG Peptide - middle region; AR; AREGB; CRDGF; MGC13647; SDGF; AREG blocking peptide
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Predicted Reactivity: Cow, Dog, Horse, Human, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Lyophilized; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR
Applicable Applications for AREG blocking peptide
Western Blot (WB)
Protein Size (# AA)
252 amino acids
Description of Target
The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype.
Protein Interactions
KRTAP10-3; WDR92; UBC; APP; UBQLN4; WT1; EGFR; CCND3; MMP9;
Blocking Peptide
Preparation and Storage
For long term storage, store at -20C. Avoid repeat freeze-thaw cycles.
Related Product Information for AREG blocking peptide
This is a synthetic peptide designed for use in combination with anti-AREG Antibody, made

Target Description: The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype.
Product Categories/Family for AREG blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
374
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
amphiregulin preproprotein
NCBI Official Synonym Full Names
amphiregulin
NCBI Official Symbol
AREG
NCBI Official Synonym Symbols
AR; SDGF; AREGB; CRDGF
NCBI Protein Information
amphiregulin
UniProt Protein Name
Amphiregulin
Protein Family
UniProt Gene Name
AREG
UniProt Synonym Gene Names
SDGF; AR; CRDGF
UniProt Entry Name
AREG_HUMAN

NCBI Description

The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). The protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells, and it inhibits the growth of certain aggressive carcinoma cell lines. It also functions in mammary gland, oocyte and bone tissue development. This gene is associated with a psoriasis-like skin phenotype, and is also associated with other pathological disorders, including various types of cancers and inflammatory conditions. [provided by RefSeq, Apr 2014]

Uniprot Description

AREG: Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts. Belongs to the amphiregulin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; cell surface; cytoplasm; integral to membrane; nucleus

Molecular Function: protein binding; growth factor activity; cytokine activity; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; response to peptide hormone stimulus; response to cAMP; response to glucocorticoid stimulus; response to estradiol stimulus; glial cell proliferation; G-protein coupled receptor protein signaling pathway; cell proliferation; cell-cell signaling; response to hydrogen peroxide; positive regulation of cell proliferation; negative regulation of osteoblast differentiation; neurite development; positive regulation of DNA replication; positive regulation of phosphorylation

Research Articles on AREG

Similar Products

Product Notes

The AREG areg (Catalog #AAA3224924) is a Blocking Peptide produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AREG Peptide - middle region reacts with Human Predicted Reactivity: Cow, Dog, Horse, Human, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AREG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AREG areg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PQIPGYIVDD SVRVEQVVKP PQNKTESENT SDKPKRKKKG GKNGKNRRNR. It is sometimes possible for the material contained within the vial of "AREG, Polyclonal Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.