Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human APOC1 Polyclonal Antibody | anti-APOC1 antibody

APOC1 (Apolipoprotein C-I, Apo-CIB, ApoC-IB, Apolipoprotein C1, APOC1B) (MaxLight 405)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOC1; Polyclonal Antibody; APOC1 (Apolipoprotein C-I; Apo-CIB; ApoC-IB; Apolipoprotein C1; APOC1B) (MaxLight 405); anti-APOC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human APOC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-APOC1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human APOC1, aa1-83 (NP_001636.1).
Immunogen Sequence
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-APOC1 antibody
APOC1 is a member of the apolipoprotein C1 family. This protein is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages.
Product Categories/Family for anti-APOC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
341
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,332 Da
NCBI Official Full Name
apolipoprotein C-I
NCBI Official Synonym Full Names
apolipoprotein C-I
NCBI Official Symbol
APOC1
NCBI Protein Information
apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1
UniProt Protein Name
Apolipoprotein C-I
Protein Family
UniProt Gene Name
APOC1
UniProt Synonym Gene Names
APOC1B; Apo-CIB; ApoC-IB; Apo-CIB'; ApoC-IB'
UniProt Entry Name
APOC1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

APOC1: Appears to modulate the interaction of APOE with beta- migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification. Belongs to the apolipoprotein C1 family.

Protein type: Lipid-binding; Inhibitor; Secreted, signal peptide; Secreted; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: chylomicron; endoplasmic reticulum

Molecular Function: phospholipase inhibitor activity; lipase inhibitor activity; phosphatidylcholine binding; fatty acid binding

Biological Process: positive regulation of catalytic activity; cholesterol metabolic process; negative regulation of cholesterol transport; cholesterol efflux; lipoprotein metabolic process; triacylglycerol metabolic process; phospholipid efflux; negative regulation of lipid catabolic process; negative regulation of receptor-mediated endocytosis; negative regulation of lipoprotein lipase activity; lipid metabolic process; regulation of cholesterol transport; negative regulation of lipid metabolic process; negative regulation of fatty acid biosynthetic process

Research Articles on APOC1

Similar Products

Product Notes

The APOC1 apoc1 (Catalog #AAA6370083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOC1 (Apolipoprotein C-I, Apo-CIB, ApoC-IB, Apolipoprotein C1, APOC1B) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOC1 apoc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.