Rabbit anti-Human APOC1 Polyclonal Antibody | anti-APOC1 antibody

APOC1 (Apolipoprotein C-I, Apo-CIB, ApoC-IB, Apolipoprotein C1, APOC1B) (MaxLight 405)

Cat. Num. AAA6370083

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: APOC1; Polyclonal Antibody; APOC1 (Apolipoprotein C-I; Apo-CIB; ApoC-IB; Apolipoprotein C1; APOC1B) (MaxLight 405); anti-APOC1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human APOC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

• Applicable Applications for anti-APOC1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human APOC1, aa1-83 (NP_001636.1).
• Immunogen Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
• Conjugate: MaxLight405
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-APOC1 antibody

APOC1 is a member of the apolipoprotein C1 family. This protein is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages.

Product Categories/Family for anti-APOC1 antibody

Antibodies; Lipoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 4502157
• NCBI GeneID: 341
• NCBI Accession #: NP_001636.1
• NCBI GenBank Nucleotide #: NM_001645.3
• UniProt Accession #: P02654; Q6IB97
• Molecular Weight: 9,332 Da
• NCBI Official Full Name: apolipoprotein C-I
• NCBI Official Synonym Full Names: apolipoprotein C-I
• NCBI Official Symbol: APOC1
• NCBI Protein Information: apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1
• UniProt Protein Name: Apolipoprotein C-I
• Protein Family: Apolipoprotein
• UniProt Gene Name: APOC1
• UniProt Synonym Gene Names: APOC1B; Apo-CIB; ApoC-IB; Apo-CIB'; ApoC-IB'
• UniProt Entry Name: APOC1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

APOC1: Appears to modulate the interaction of APOE with beta- migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification. Belongs to the apolipoprotein C1 family.

Protein type: Lipid-binding; Inhibitor; Secreted, signal peptide; Secreted; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: chylomicron; endoplasmic reticulum

Molecular Function: phospholipase inhibitor activity; lipase inhibitor activity; phosphatidylcholine binding; fatty acid binding

Biological Process: positive regulation of catalytic activity; cholesterol metabolic process; negative regulation of cholesterol transport; cholesterol efflux; lipoprotein metabolic process; triacylglycerol metabolic process; phospholipid efflux; negative regulation of lipid catabolic process; negative regulation of receptor-mediated endocytosis; negative regulation of lipoprotein lipase activity; lipid metabolic process; regulation of cholesterol transport; negative regulation of lipid metabolic process; negative regulation of fatty acid biosynthetic process