Mouse anti-Human APOC1 Monoclonal Antibody | anti-APOC1 antibody

APOC1 (Apolipoprotein C-I, Apo-CIB, ApoC-IB, Apolipoprotein C1, APOC1B) APC

Cat. Num. AAA6135330

• Gene Names: APOC1; Apo-CI; ApoC-I; apo-CIB; apoC-IB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: APOC1; Monoclonal Antibody; APOC1 (Apolipoprotein C-I; Apo-CIB; ApoC-IB; Apolipoprotein C1; APOC1B) APC; anti-APOC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E2-1A3
• Specificity: Recognizes human APOC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 402

• Applicable Applications for anti-APOC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-83 from human APOC1 (AAH09698) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.87kD).)

Western Blot (WB)

(APOC1 monoclonal antibody Western Blot analysis of APOC1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody. Lane 1: APOC1 transfected lysate (9kD) Lane 2: Non-transfected lysate.)

Related Product Information for anti-APOC1 antibody

APOC1 is a member of the apolipoprotein C1 family. This protein is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages.

Product Categories/Family for anti-APOC1 antibody

Antibodies; Lipoproteins

References

1. Proteins related to lipoprotein profile were identified using a pharmaco-proteomic approach as markers for growth response to growth hormone (GH) treatment in short prepubertal children. Andersson B, Hellgren G, Nierop AF, Hochberg Z, Albertsson-Wikland K.Proteome Sci. 2009 Nov 2;7:40. 2. Apolipoprotein C1 association with Hepatitis C Virus. Meunier JC, Russell RS, Engle RH, Faulk KN, Purcell RH, Emerson SU.J Virol. 2008 Oct;82(19):9647-56. Epub 2008 Jul 30.

NCBI and Uniprot Product Information

• NCBI GI #: 34783257
• NCBI GeneID: 341
• NCBI Official Full Name: Homo sapiens apolipoprotein C-I, mRNA
• NCBI Official Synonym Full Names: apolipoprotein C1
• NCBI Official Symbol: APOC1
• NCBI Official Synonym Symbols: Apo-CI; ApoC-I; apo-CIB; apoC-IB
• NCBI Protein Information: apolipoprotein C-I
• Protein Family: Apolipoprotein

NCBI Description

This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016]