Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.87kD).)

Mouse anti-Human APOC1 Monoclonal Antibody | anti-APOC1 antibody

APOC1 (Apolipoprotein C-I, Apo-CIB, ApoC-IB, Apolipoprotein C1, APOC1B) (PE)

Gene Names
APOC1; Apo-CI; ApoC-I; apo-CIB; apoC-IB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOC1; Monoclonal Antibody; APOC1 (Apolipoprotein C-I; Apo-CIB; ApoC-IB; Apolipoprotein C1; APOC1B) (PE); anti-APOC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E2-1A3
Specificity
Recognizes human APOC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
402
Applicable Applications for anti-APOC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-83 from human APOC1 (AAH09698) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.87kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.87kD).)

Western Blot (WB)

(APOC1 monoclonal antibody Western Blot analysis of APOC1 expression in human liver.)

Western Blot (WB) (APOC1 monoclonal antibody Western Blot analysis of APOC1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody. Lane 1: APOC1 transfected lysate (9kD) Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody. Lane 1: APOC1 transfected lysate (9kD) Lane 2: Non-transfected lysate.)
Related Product Information for anti-APOC1 antibody
APOC1 is a member of the apolipoprotein C1 family. This protein is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages.
Product Categories/Family for anti-APOC1 antibody
References
1. Proteins related to lipoprotein profile were identified using a pharmaco-proteomic approach as markers for growth response to growth hormone (GH) treatment in short prepubertal children. Andersson B, Hellgren G, Nierop AF, Hochberg Z, Albertsson-Wikland K.Proteome Sci. 2009 Nov 2;7:40. 2. Apolipoprotein C1 association with Hepatitis C Virus. Meunier JC, Russell RS, Engle RH, Faulk KN, Purcell RH, Emerson SU.J Virol. 2008 Oct;82(19):9647-56. Epub 2008 Jul 30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
341
NCBI Official Full Name
Homo sapiens apolipoprotein C-I, mRNA
NCBI Official Synonym Full Names
apolipoprotein C1
NCBI Official Symbol
APOC1
NCBI Official Synonym Symbols
Apo-CI; ApoC-I; apo-CIB; apoC-IB
NCBI Protein Information
apolipoprotein C-I
Protein Family

NCBI Description

This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Research Articles on APOC1

Similar Products

Product Notes

The APOC1 (Catalog #AAA6156542) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APOC1 (Apolipoprotein C-I, Apo-CIB, ApoC-IB, Apolipoprotein C1, APOC1B) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.