Immunohistochemistry (IHC)
(Rabbit Anti-APOBEC2 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit APOBEC2 Polyclonal Antibody | anti-APOBEC2 antibody
APOBEC2 antibody - N-terminal region
Gene Names
APOBEC2; ARP1; ARCD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
APOBEC2; Polyclonal Antibody; APOBEC2 antibody - N-terminal region; anti-APOBEC2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
Sequence Length
224
Applicable Applications for anti-APOBEC2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 90%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-APOBEC2 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-APOBEC2 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-APOBEC2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-APOBEC2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-APOBEC2 antibody
This is a rabbit polyclonal antibody against APOBEC2. It was validated on Western Blot and immunohistochemistry
Target Description: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
Target Description: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
Product Categories/Family for anti-APOBEC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
C->U-editing enzyme APOBEC-2
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 2
NCBI Official Symbol
APOBEC2
NCBI Official Synonym Symbols
ARP1; ARCD1
NCBI Protein Information
C->U-editing enzyme APOBEC-2
UniProt Protein Name
Probable C->U-editing enzyme APOBEC-2
Protein Family
UniProt Gene Name
APOBEC2
UniProt Entry Name
ABEC2_HUMAN
Uniprot Description
APOBEC2: Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation. Belongs to the cytidine and deoxycytidylate deaminase family.
Protein type: EC 3.5.4.-; Hydrolase; RNA-binding
Chromosomal Location of Human Ortholog: 6p21
Molecular Function: zinc ion binding; RNA binding; cytidine deaminase activity
Biological Process: mRNA modification; cytidine deamination; mRNA processing
Research Articles on APOBEC2
Similar Products
Product Notes
The APOBEC2 apobec2 (Catalog #AAA3205412) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the APOBEC2 apobec2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VATEAASQNG EDLENLDDPE KLKELIELPP FEIVTGERLP ANFFKFQFRN. It is sometimes possible for the material contained within the vial of "APOBEC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
