Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-APOA4 Antibody Titration: 0.2-1 ug/mlPositive Control: NTERA2 cell lysate)

Rabbit anti-Human APOA4 Polyclonal Antibody | anti-APOA4 antibody

APOA4 antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOA4; Polyclonal Antibody; APOA4 antibody - C-terminal region; anti-APOA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ
Sequence Length
396
Applicable Applications for anti-APOA4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human APOA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-APOA4 Antibody Titration: 0.2-1 ug/mlPositive Control: NTERA2 cell lysate)

Western Blot (WB) (WB Suggested Anti-APOA4 Antibody Titration: 0.2-1 ug/mlPositive Control: NTERA2 cell lysate)
Related Product Information for anti-APOA4 antibody
This is a rabbit polyclonal antibody against APOA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-APOA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
337
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
apolipoprotein A-IV
NCBI Official Synonym Full Names
apolipoprotein A4
NCBI Official Symbol
APOA4
NCBI Protein Information
apolipoprotein A-IV
UniProt Protein Name
Apolipoprotein A-IV
Protein Family
UniProt Gene Name
APOA4
UniProt Synonym Gene Names
Apo-AIV; ApoA-IV
UniProt Entry Name
APOA4_HUMAN

NCBI Description

Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. [provided by RefSeq, Jul 2008]

Uniprot Description

APOA4: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Synthesized primarily in the intestine and secreted in plasma. Belongs to the apolipoprotein A1/A4/E family.

Protein type: Cell adhesion; Endoplasmic reticulum; Lipid-binding; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: extracellular space; chylomicron; cell surface; endoplasmic reticulum lumen; early endosome; extracellular region; cytosol

Molecular Function: lipid transporter activity; antioxidant activity; protein binding; protein homodimerization activity; copper ion binding; cholesterol transporter activity; cholesterol binding; phosphatidylcholine binding; lipid binding

Biological Process: multicellular organismal lipid catabolic process; positive regulation of fatty acid biosynthetic process; phototransduction, visible light; cholesterol metabolic process; removal of superoxide radicals; neurite regeneration; lipid homeostasis; protein-lipid complex assembly; cholesterol efflux; lipoprotein metabolic process; lipid transport; cholesterol biosynthetic process; phosphatidylcholine metabolic process; cholesterol homeostasis; leukocyte adhesion; reverse cholesterol transport; phospholipid efflux; innate immune response in mucosa; regulation of cholesterol absorption; response to lipid hydroperoxide; hydrogen peroxide catabolic process; positive regulation of lipoprotein lipase activity; retinoid metabolic process; regulation of cholesterol transport

Research Articles on APOA4

Similar Products

Product Notes

The APOA4 apoa4 (Catalog #AAA3211598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOA4 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOA4 apoa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQKLGPHAGD VEGHLSFLEK DLRDKVNSFF STFKEKESQD KTLSLPELEQ. It is sometimes possible for the material contained within the vial of "APOA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.