Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (APEX1 rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562.)

Rabbit anti-Human APEX1 Polyclonal Antibody | anti-APEX1 antibody

APEX1 (DNA-(Apurinic or Apyrimidinic Site) Lyase, APEX Nuclease, APEN, Apurinic-apyrimidinic Endonuclease 1, AP Endonuclease 1, APE-1, REF-1, Redox Factor-1, APE, APE1, APEX, APX, HAP1, REF1) (FITC)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APEX1; Polyclonal Antibody; APEX1 (DNA-(Apurinic or Apyrimidinic Site) Lyase; APEX Nuclease; APEN; Apurinic-apyrimidinic Endonuclease 1; AP Endonuclease 1; APE-1; REF-1; Redox Factor-1; APE; APE1; APEX; APX; HAP1; REF1) (FITC); anti-APEX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human APEX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
318
Applicable Applications for anti-APEX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human APEX1, aa1-318 (NP_001632.1).
Immunogen Sequence
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(APEX1 rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562.)

Western Blot (WB) (APEX1 rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of APEX1 expression in transfected 293T cell line by APEX1 polyclonal antibody. Lane 1: APEX1 transfected lysate (34.98kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of APEX1 expression in transfected 293T cell line by APEX1 polyclonal antibody. Lane 1: APEX1 transfected lysate (34.98kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-APEX1 antibody
Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.
Product Categories/Family for anti-APEX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
APEX nuclease (multifunctional DNA repair enzyme)
UniProt Protein Name
DNA-(apurinic or apyrimidinic site) lyase
UniProt Gene Name
APEX1
UniProt Synonym Gene Names
APE; APE1; APEX; APX; HAP1; REF1; APEN; AP endonuclease 1; APE-1
UniProt Entry Name
APEX1_HUMAN

Uniprot Description

APE1: a multifunctional enzyme that plays a central role in the cellular response to oxidative stress including DNA repair and redox regulation of transcriptional factors. Binds DNA and RNA. Functions as an apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway, a 3'-5' exoribonuclease for mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules, and a DNA 3' phosphodiesterase capable of removing lesions (such as phosphoglycolate) blocking the 3' side of DNA strand breaks. Is a loading factor for POLB onto non-incised AP sites in DNA, stimulates the 5'-terminal deoxyribose 5'- phosphate (dRp) excision activity of POLB, and involved in the DNA cleavage step of class switch recombination (CSR). Possesses reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. Binds to negative calcium response elements (nCaREs). Stimulates the YBX1-mediated MDR1 promoter activity, when acetylated at Lys-6 and Lys-7, leading to drug resistance. Is an endoribonuclease involved in the control of single-stranded RNA metabolism. Plays a role in regulating MYC mRNA turnover. In association with NMD1, plays a role in the rRNA quality control process during cell cycle progression. Interacts with SIRT1; the interaction is increased in the context of genotoxic stress. Interacts with HDAC1, HDAC2 and HDAC3; the interactions are not dependent on the APEX1 acetylation status. Up-regulated in presence of reactive oxygen species (ROS), like bleomycin, H2O2 and phenazine methosulfate. NPM1 stimulates endodeoxyribonuclease activity on double-stranded DNA with AP sites, but inhibits endoribonuclease activity on single-stranded RNA containing AP sites. Belongs to the DNA repair enzymes AP/ExoA family.

Protein type: DNA-binding; EC 4.2.99.18; Nuclear receptor co-regulator; Deoxyribonuclease; Nucleolus; DNA repair, damage; Hydrolase; Endoplasmic reticulum; Lyase; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: nucleoplasm; centrosome; transcription factor complex; mitochondrion; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; nucleolus; ribosome; nuclear speck; nucleus

Molecular Function: phosphodiesterase I activity; DNA-(apurinic or apyrimidinic site) lyase activity; phosphoric diester hydrolase activity; uracil DNA N-glycosylase activity; chromatin DNA binding; metal ion binding; transcription coactivator activity; oxidoreductase activity; endodeoxyribonuclease activity; NF-kappaB binding; protein binding; DNA binding; endonuclease activity; protein complex binding; damaged DNA binding; ribonuclease H activity; 3'-5' exonuclease activity; transcription corepressor activity; double-stranded DNA specific 3'-5' exodeoxyribonuclease activity; site-specific endodeoxyribonuclease activity, specific for altered base

Biological Process: response to drug; positive regulation of DNA repair; mismatch repair; transcription, DNA-dependent; negative regulation of smooth muscle cell migration; DNA strand elongation during DNA replication; DNA repair; regulation of mRNA stability; DNA catabolic process, endonucleolytic; double-strand break repair via homologous recombination; telomere maintenance via semi-conservative replication; regulation of transcription, DNA-dependent; cell redox homeostasis; nucleotide-excision repair; base-excision repair; transcription-coupled nucleotide-excision repair; double-strand break repair; telomere maintenance via recombination; nucleotide-excision repair, DNA gap filling; mitotic cell cycle; DNA catabolic process, exonucleolytic; telomere maintenance; aging

Similar Products

Product Notes

The APEX1 apex1 (Catalog #AAA6370004) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APEX1 (DNA-(Apurinic or Apyrimidinic Site) Lyase, APEX Nuclease, APEN, Apurinic-apyrimidinic Endonuclease 1, AP Endonuclease 1, APE-1, REF-1, Redox Factor-1, APE, APE1, APEX, APX, HAP1, REF1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APEX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APEX1 apex1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APEX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.