Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using AP1B1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)
Rabbit AP1B1 Polyclonal Antibody | anti-AP1B1 antibody
AP1B1 Rabbit pAb
Gene Names
AP1B1; ADTB1; BAM22; AP105A; CLAPB2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
AP1B1; Polyclonal Antibody; AP1B1 Rabbit pAb; ADTB1; AP105A; BAM22; CLAPB2; anti-AP1B1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTV
Applicable Applications for anti-AP1B1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human AP1B1 (NP_001118.3).
Positive Samples
293T, C6, Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using AP1B1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using AP1B1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)
Related Product Information for anti-AP1B1 antibody
Background: Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as one of the large subunits of this complex and is a member of the adaptin protein family. This gene is a candidate meningioma gene. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
101,348 Da
NCBI Official Full Name
AP-1 complex subunit beta-1 isoform a
NCBI Official Synonym Full Names
adaptor-related protein complex 1, beta 1 subunit
NCBI Official Symbol
AP1B1
NCBI Official Synonym Symbols
ADTB1; BAM22; AP105A; CLAPB2
NCBI Protein Information
AP-1 complex subunit beta-1; Golgi adaptor HA1/AP1 adaptin beta subunit; adapter-related protein complex 1 subunit beta-1; adaptor protein complex AP-1 subunit beta-1; adaptor-related protein complex 1 subunit beta-1; beta-1-adaptin; beta-adaptin 1; beta-
UniProt Protein Name
AP-1 complex subunit beta-1
Protein Family
UniProt Gene Name
AP1B1
UniProt Synonym Gene Names
ADTB1; BAM22; CLAPB2
UniProt Entry Name
AP1B1_HUMAN
Similar Products
Product Notes
The AP1B1 ap1b1 (Catalog #AAA9142262) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AP1B1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AP1B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the AP1B1 ap1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDLFDLTSGV GTLSGSYVAP KAVWLPAMKA KGLEISGTFT RQVGSISMDL QLTNKALQVM TDFAIQFNRN SFGLAPAAPL QVHAPLSPNQ TVEISLPLST V. It is sometimes possible for the material contained within the vial of "AP1B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
