Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in human liver.)

Rabbit anti-Human, Mouse ANXA5 Polyclonal Antibody | anti-ANXA5 antibody

ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII,

Gene Names
ANXA5; PP4; ANX5; ENX2; RPRGL3; HEL-S-7
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANXA5; Polyclonal Antibody; ANXA5 (Annexin A5; Annexin-5; Annexin V; Lipocortin V; Endonexin II; Calphobindin I; CBP-I; Placental Anticoagulant Protein I; PAP-I; Placental Anticoagulant Protein 4; PP4; Thromboplastin Inhibitor; Vascular Anticoagulant-alpha; VAC-alpha; Anchorin CII; ; anti-ANXA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ANXA5. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ANXA5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ANXA5, aa1-320 (NP_001145.1).
Immunogen Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in human liver.)

Western Blot (WB) (ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in human liver.)

Western Blot (WB)

(ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in mouse liver.)

Western Blot (WB) (ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in mouse liver.)

Western Blot (WB)

(ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in HepG2.)

Western Blot (WB) (ANXA5 rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in HepG2.)
Related Product Information for anti-ANXA5 antibody
Annexin 5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
Product Categories/Family for anti-ANXA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
308
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,937 Da
NCBI Official Full Name
annexin A5
NCBI Official Synonym Full Names
annexin A5
NCBI Official Symbol
ANXA5
NCBI Official Synonym Symbols
PP4; ANX5; ENX2; RPRGL3; HEL-S-7
NCBI Protein Information
annexin A5; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; epididymis secretory protein Li 7; placental anticoagulant protein 4; placental an
UniProt Protein Name
Annexin A5
Protein Family
UniProt Gene Name
ANXA5
UniProt Synonym Gene Names
ANX5; ENX2; PP4; CBP-I; PP4; PAP-I; VAC-alpha
UniProt Entry Name
ANXA5_HUMAN

NCBI Description

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]

Uniprot Description

ANXA5: a calcium/phospholipid-binding protein and an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. The binding of labeled ANXA5 to phosphatidylserine is used as a marker of apoptosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Calcium-binding; Inhibitor; Lipid-binding; Apoptosis

Chromosomal Location of Human Ortholog: 4q27

Cellular Component: focal adhesion; membrane; cytoplasm; intracellular; external side of plasma membrane

Molecular Function: phospholipase inhibitor activity; calcium-dependent phospholipid binding; phospholipid binding; calcium ion binding

Biological Process: response to organic substance; negative regulation of catalytic activity; negative regulation of coagulation; blood coagulation; signal transduction; negative regulation of apoptosis

Disease: Pregnancy Loss, Recurrent, Susceptibility To, 3

Research Articles on ANXA5

Similar Products

Product Notes

The ANXA5 anxa5 (Catalog #AAA6369956) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII, reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANXA5 anxa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANXA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.