Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ANXA13 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit ANXA13 Polyclonal Antibody | anti-ANXA13 antibody

ANXA13 antibody - N-terminal region

Gene Names
ANXA13; ISA; ANX13
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ANXA13; Polyclonal Antibody; ANXA13 antibody - N-terminal region; anti-ANXA13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS
Sequence Length
357
Applicable Applications for anti-ANXA13 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ANXA13 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ANXA13 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ANXA13 antibody
This is a rabbit polyclonal antibody against ANXA13. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The ANXA13 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
312
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
annexin A13 isoform b
NCBI Official Synonym Full Names
annexin A13
NCBI Official Symbol
ANXA13
NCBI Official Synonym Symbols
ISA; ANX13
NCBI Protein Information
annexin A13
UniProt Protein Name
Annexin A13
Protein Family
UniProt Gene Name
ANXA13
UniProt Synonym Gene Names
ANX13; ISA
UniProt Entry Name
ANX13_HUMAN

NCBI Description

This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ANXA13: a calcium/phospholipid-binding protein associated with the cell membrane. ANXA13 is the probable common ancestor of the annexin family of proteins. Annexins all bind to phospholipids in a calcium-dependent manner. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Lipid-binding; Calcium-binding

Chromosomal Location of Human Ortholog: 8q24.13

Cellular Component: nucleoplasm; extracellular space; basolateral plasma membrane; apical plasma membrane; plasma membrane; lipid raft

Molecular Function: calcium-dependent phospholipid binding; phosphatidylserine binding; calcium ion binding; phosphatidylcholine binding

Biological Process: negative regulation of Golgi to plasma membrane protein transport; positive regulation of Golgi to plasma membrane protein transport; cell differentiation

Research Articles on ANXA13

Similar Products

Product Notes

The ANXA13 anxa13 (Catalog #AAA3203206) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA13 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANXA13 anxa13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKLNKACKGM GTNEAAIIEI LSGRTSDERQ QIKQKYKATY GKELEEVLKS. It is sometimes possible for the material contained within the vial of "ANXA13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.