Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of Annexin VIII using anti-Annexin VIII antibody (MBS178708).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Annexin VIII antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Annexin VIII at approximately 37KD. The expected band size for Annexin VIII is at 37KD. )

Rabbit anti-Human Annexin VIII Polyclonal Antibody | anti-ANXA8 antibody

Anti-Annexin VIII Antibody

Gene Names
ANXA8; ANX8; CH17-360D5.2
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Annexin VIII; Polyclonal Antibody; Anti-Annexin VIII Antibody; Annexin-8; AnnexinVIII; ANX8; ANXA8; P13928; VAC-beta; Vascular anticoagulant-beta; Annexin A8; anti-ANXA8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
327
Applicable Applications for anti-ANXA8 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of Annexin VIII using anti-Annexin VIII antibody (MBS178708).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Annexin VIII antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Annexin VIII at approximately 37KD. The expected band size for Annexin VIII is at 37KD. )

Western Blot (WB) (Figure 1. Western blot analysis of Annexin VIII using anti-Annexin VIII antibody (MBS178708).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Annexin VIII antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Annexin VIII at approximately 37KD. The expected band size for Annexin VIII is at 37KD. )
Related Product Information for anti-ANXA8 antibody
Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection.
Background: ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
References
1. Chambers, J. A., Gardner, E., Hauptmann, R., Ponder, B. A., Mulligan, L. M. TaqI polymorphisms at the annexin VIII locus (ANX8). Hum. Molec. Genet. 1: 550 only, 1992.
2. Chang, K.-S., Wang, G., Freireich, E. J., Daly, M., Naylor, S. L., Trujillo, J. M., Stass, S. A. Specific expression of the annexin VIIIgene in acute promyelocytic leukemia. Blood 79: 1802-1810, 1992.
3. Sarkar, A., Yang, P., Fan, Y.-H., Mu, Z. M., Hauptmann, R., Adolf, G. R., Stass, S. A., Chang, K.-S. Regulation of the expression ofannexin VIII in acute promyelocytic leukemia. Blood 84: 279-286, 1994.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,017 Da
NCBI Official Full Name
annexin A8 isoform 2
NCBI Official Synonym Full Names
annexin A8
NCBI Official Symbol
ANXA8
NCBI Official Synonym Symbols
ANX8; CH17-360D5.2
NCBI Protein Information
annexin A8
UniProt Protein Name
Annexin A8
Protein Family
UniProt Gene Name
ANXA8
UniProt Synonym Gene Names
VAC-beta

NCBI Description

This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. [provided by RefSeq, Jul 2008]

Uniprot Description

This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Research Articles on ANXA8

Similar Products

Product Notes

The ANXA8 anxa8 (Catalog #AAA178708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Annexin VIII Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Annexin VIII can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ANXA8 anxa8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Annexin VIII, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.