Rabbit anti-Human ANGPTL3 Polyclonal Antibody | anti-ANGPTL3 antibody

ANGPTL3 (Angiopoietin-related Protein 3, Angiopoietin-5, ANG-5, Angiopoietin-like Protein 3, ANGPT5, FHBL2, UNQ153/PRO179) (PE)

Cat. Num. AAA6369824

• Gene Names: ANGPTL3; ANL3; ANG-5; FHBL2; ANGPT5
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANGPTL3; Polyclonal Antibody; ANGPTL3 (Angiopoietin-related Protein 3; Angiopoietin-5; ANG-5; Angiopoietin-like Protein 3; ANGPT5; FHBL2; UNQ153/PRO179) (PE); anti-ANGPTL3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ANGPTL3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ANGPTL3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ANGPTL3, aa1-460 (NP_055310.1).
• Immunogen Sequence: MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ANGPTL3 expression in transfected 293T cell line by 123318. Lane 1: ANGPTL3 transfected lysate (53.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ANGPTL3 antibody

Angiopoietin-like 3 (ANGPTL3 or ANGPT5), a liver specific protein, is a secreted factor consisting of an N-terminal coiled-coil domain and C-terminal fibrinogen-like domain. ANGPTL3 is structurally similar to angiopoietins, which are vascular endothelial growth factors. ANGTPLs (ANGTPL3, ANGPTL4 and ANGPTL6) have a major impact on lipid and possibly glucose metabolism. These proteins also have important effects on plasma triacylglycerol clearance, adipose tissue lipolysis, and adiposity.

Product Categories/Family for anti-ANGPTL3 antibody

Antibodies; Angiopoietin

NCBI and Uniprot Product Information

• NCBI GI #: 7656888
• NCBI GeneID: 27329
• NCBI Accession #: NP_055310.1
• NCBI GenBank Nucleotide #: NM_014495
• Molecular Weight: 53,637 Da
• NCBI Official Full Name: angiopoietin-related protein 3 preproprotein
• NCBI Official Synonym Full Names: angiopoietin-like 3
• NCBI Official Symbol: ANGPTL3
• NCBI Official Synonym Symbols: ANL3; ANG-5; FHBL2; ANGPT5
• NCBI Protein Information: angiopoietin-related protein 3; angiopoietin 5
• Protein Family: Angiopoietin-related protein

NCBI Description

This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metablism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Feb 2013]