Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ANAPC10 expression in transfected 293T cell line by ANAPC10 polyclonal antibody. Lane 1: ANAPC10 transfected lysate (21.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ANAPC10 Polyclonal Antibody | anti-ANAPC10 antibody

ANAPC10 (APC10, Anaphase-promoting Complex Subunit 10, Cyclosome Subunit 10, DKFZp564L0562, DKFZP564L0562, DOC1) (Biotin)

Gene Names
ANAPC10; DOC1; APC10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANAPC10; Polyclonal Antibody; ANAPC10 (APC10; Anaphase-promoting Complex Subunit 10; Cyclosome Subunit 10; DKFZp564L0562; DKFZP564L0562; DOC1) (Biotin); anti-ANAPC10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ANAPC10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ANAPC10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human ANAPC10, aa1-185 (AAH05217.1).
Immunogen Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ANAPC10 expression in transfected 293T cell line by ANAPC10 polyclonal antibody. Lane 1: ANAPC10 transfected lysate (21.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ANAPC10 expression in transfected 293T cell line by ANAPC10 polyclonal antibody. Lane 1: ANAPC10 transfected lysate (21.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ANAPC10 antibody
APC is a ubiquitin ligase which specifically targets mitotic regulatory factors such as Pds 1/Cut 2 and cyclin B. It was found that APC 10/Doc 1 is localized in centrosomes and mitotic spindles throughout mitosis, while it is also localized in kinetochores from prophase to anaphase and in mid body in telophase and cytokinesis. These results strongly support the notion that human APC 10/Doc 1 may be one of the APC core subunits rather than the transiently associated regulatory factor.
Product Categories/Family for anti-ANAPC10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
21,252 Da
NCBI Official Full Name
Homo sapiens anaphase promoting complex subunit 10, mRNA
NCBI Official Synonym Full Names
anaphase promoting complex subunit 10
NCBI Official Symbol
ANAPC10
NCBI Official Synonym Symbols
DOC1; APC10
NCBI Protein Information
anaphase-promoting complex subunit 10

NCBI Description

ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]

Research Articles on ANAPC10

Similar Products

Product Notes

The ANAPC10 (Catalog #AAA6369794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANAPC10 (APC10, Anaphase-promoting Complex Subunit 10, Cyclosome Subunit 10, DKFZp564L0562, DKFZP564L0562, DOC1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANAPC10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANAPC10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANAPC10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.