Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Anaphase-promoting complex subunit 10 (ANAPC10) Recombinant Protein | ANAPC10 recombinant protein

Recombinant Human Anaphase-promoting complex subunit 10 (ANAPC10)

Gene Names
ANAPC10; DOC1; APC10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Anaphase-promoting complex subunit 10 (ANAPC10); Recombinant Human Anaphase-promoting complex subunit 10 (ANAPC10); Anaphase-promoting complex subunit 10; APC10; Cyclosome subunit 10; ANAPC10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-185aa; Full Length
Sequence
TTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Sequence Length
184
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for ANAPC10 recombinant protein
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Product Categories/Family for ANAPC10 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.1 kDa
NCBI Official Full Name
anaphase-promoting complex subunit 10 isoform 1
NCBI Official Synonym Full Names
anaphase promoting complex subunit 10
NCBI Official Symbol
ANAPC10
NCBI Official Synonym Symbols
DOC1; APC10
NCBI Protein Information
anaphase-promoting complex subunit 10; cyclosome subunit 10
UniProt Protein Name
Anaphase-promoting complex subunit 10
UniProt Gene Name
ANAPC10
UniProt Synonym Gene Names
APC10; APC10
UniProt Entry Name
APC10_HUMAN

NCBI Description

ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]

Uniprot Description

APC10: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Belongs to the APC10 family.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 4q31

Cellular Component: nucleoplasm; anaphase-promoting complex; cytosol

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; mitosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle

Research Articles on ANAPC10

Similar Products

Product Notes

The ANAPC10 anapc10 (Catalog #AAA1402914) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-185aa; Full Length. The amino acid sequence is listed below: TTPNKTPPGA DPKQLERTGT VREIGSQAVW SLSSCKPGFG VDQLRDDNLE TYWQSDGSQP HLVNIQFRRK TTVKTLCIYA DYKSDESYTP SKISVRVGNN FHNLQEIRQL ELVEPSGWIH VPLTDNHKKP TRTFMIQIAV LANHQNGRDT HMRQIKIYTP VEESSIGKFP RCTTIDFMMY RSIR. It is sometimes possible for the material contained within the vial of "Anaphase-promoting complex subunit 10 (ANAPC10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.