Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AMY1C rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in human pancreas.)

Rabbit anti-Human AMY1C Polyclonal Antibody | anti-AMY1C antibody

AMY1C (Alpha-amylase 1, 1,4-alpha-D-glucan Glucanohydrolase 1, Salivary alpha-amylase, AMY1A, AMY1B) (HRP)

Gene Names
AMY1C; AMY1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AMY1C; Polyclonal Antibody; AMY1C (Alpha-amylase 1; 1; 4-alpha-D-glucan Glucanohydrolase 1; Salivary alpha-amylase; AMY1A; AMY1B) (HRP); anti-AMY1C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AMY1C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
1597
Applicable Applications for anti-AMY1C antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AMY1C, aa1-511 (AAI56581.1).
Immunogen Sequence
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AMY1C rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in human pancreas.)

Western Blot (WB) (AMY1C rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in human pancreas.)

Western Blot (WB)

(AMY1C rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in HeLa.)

Western Blot (WB) (AMY1C rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of AMY1C expression in transfected 293T cell line by AMY1C polyclonal antibody. Lane 1: AMY1C transfected lysate (56.21kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AMY1C expression in transfected 293T cell line by AMY1C polyclonal antibody. Lane 1: AMY1C transfected lysate (56.21kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AMY1C antibody
Salivary Amylase is a digestive enzyme secreted by salivary glands, it consists of a single polypeptide chain with a molecular weight of 56kD (family B) or 62kD (family A), the difference in molecular weight being due to the presence or absence of a carbohydrate moiety. The total serum concentration of amylase is about 120g/L of which about 50% is salivary amylase. Although salivary amylase and pancreatic amylase share 95% aa sequence homology, they differ in molecular size, isoelectricpoint and antigenic properties.
Product Categories/Family for anti-AMY1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
278
NCBI Official Full Name
Synthetic construct Homo sapiens clone IMAGE:100062031, MGC:190145 amylase, alpha 1C (salivary) (AMY1C) mRNA, encodes complete protein
NCBI Official Synonym Full Names
amylase alpha 1C
NCBI Official Symbol
AMY1C
NCBI Official Synonym Symbols
AMY1
NCBI Protein Information
alpha-amylase 1

NCBI Description

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq, Jul 2008]

Research Articles on AMY1C

Similar Products

Product Notes

The AMY1C (Catalog #AAA6369774) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMY1C (Alpha-amylase 1, 1,4-alpha-D-glucan Glucanohydrolase 1, Salivary alpha-amylase, AMY1A, AMY1B) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMY1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMY1C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMY1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.