Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AMY1ASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human AMY1A Polyclonal Antibody | anti-AMY1A antibody

AMY1A Antibody - middle region

Gene Names
AMY1B; AMY1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AMY1A; Polyclonal Antibody; AMY1A Antibody - middle region; anti-AMY1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNND
Sequence Length
511
Applicable Applications for anti-AMY1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AMY1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AMY1ASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AMY1ASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AMY1A antibody
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-AMY1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
277
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
alpha-amylase 1
NCBI Official Synonym Full Names
amylase alpha 1B (salivary)
NCBI Official Symbol
AMY1B
NCBI Official Synonym Symbols
AMY1
NCBI Protein Information
alpha-amylase 1
UniProt Protein Name
Pancreatic alpha-amylase
UniProt Gene Name
AMY2A
UniProt Synonym Gene Names
PA
UniProt Entry Name
AMYP_HUMAN

NCBI Description

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq, Jul 2008]

Uniprot Description

AMY2A: Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jul 2008]

Protein type: EC 3.2.1.1; Secreted; Hydrolase; Secreted, signal peptide; Carbohydrate Metabolism - starch and sucrose

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: extracellular space; extracellular region

Molecular Function: alpha-amylase activity; calcium ion binding; chloride ion binding

Biological Process: polysaccharide digestion; carbohydrate catabolic process; carbohydrate metabolic process; pathogenesis

Research Articles on AMY1A

Similar Products

Product Notes

The AMY1A amy2a (Catalog #AAA3224263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMY1A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMY1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AMY1A amy2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCEHRWRQIR NMVNFRNVVD GQPFTNWYDN GSNQVAFGRG NRGFIVFNND. It is sometimes possible for the material contained within the vial of "AMY1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.