Western Blot (WB)
(Western blot analysis of extracts of mouse liver, using AMY1A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Mouse AMY1A Polyclonal Antibody | anti-AMY1A antibody
AMY1A Polyclonal Antibody
Gene Names
AMY1B; AMY1
Reactivity
Mouse
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
AMY1A; Polyclonal Antibody; AMY1A Polyclonal Antibody; AMY1; anti-AMY1A antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNH
Sequence Length
511
Applicable Applications for anti-AMY1A antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human AMY1A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of mouse liver, using AMY1A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of mouse liver, using AMY1A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded mouse kidney using AMY1A antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded mouse kidney using AMY1A antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-AMY1A antibody
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-AMY1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 57kDa
Observed: 54kDa
Observed: 54kDa
NCBI Official Full Name
alpha-amylase 1
NCBI Official Synonym Full Names
amylase, alpha 1B (salivary)
NCBI Official Symbol
AMY1B
NCBI Official Synonym Symbols
AMY1
NCBI Protein Information
alpha-amylase 1
UniProt Protein Name
Alpha-amylase 1
UniProt Gene Name
AMY1A
UniProt Synonym Gene Names
AMY1
NCBI Description
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq, Jul 2008]
Research Articles on AMY1A
Similar Products
Product Notes
The AMY1A amy1a (Catalog #AAA9133323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMY1A Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AMY1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the AMY1A amy1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QYSSNTQQGR TSIVHLFEWR WVDIALECER YLAPKGFGGV QVSPPNENVA IHNPFRPWWE RYQPVSYKLC TRSGNEDEFR NMVTRCNNVG VRIYVDAVIN HMCGNAVSAG TSSTCGSYFN PGSRDFPAVP YSGWDFNDGK CKTGSGDIEN YNDATQVRDC RLSGLLDLAL GKDYVRSKIA EYMNH. It is sometimes possible for the material contained within the vial of "AMY1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
