Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-AMOTL2 Polyclonal Antibody)

Rabbit anti-Human, Mouse AMOTL2 Polyclonal Antibody | anti-AMOTL2 antibody

AMOTL2 Polyclonal Antibody

Gene Names
AMOTL2; LCCP
Reactivity
Human, Mouse
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
AMOTL2; Polyclonal Antibody; AMOTL2 Polyclonal Antibody; LCCP; angiomotin like 2; anti-AMOTL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.39 mg/ml (varies by lot)
Sequence Length
837
Applicable Applications for anti-AMOTL2 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 638-837 of human AMOTL2 (NP_001265612.1).
Immunogen Sequence
RQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-AMOTL2 Polyclonal Antibody)

Western Blot (WB) (Western blot-AMOTL2 Polyclonal Antibody)
Related Product Information for anti-AMOTL2 antibody
Angiomotin is a protein that binds angiostatin, a circulating inhibitor of the formation of new blood vessels (angiogenesis). Angiomotin mediates angiostatin inhibition of endothelial cell migration and tube formation in vitro. The protein encoded by this gene is related to angiomotin and is a member of the motin protein family. Alternative splicing results in multiple transcript variants of this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa; 86kDa
NCBI Official Full Name
angiomotin-like protein 2 isoform 1
NCBI Official Synonym Full Names
angiomotin like 2
NCBI Official Symbol
AMOTL2
NCBI Official Synonym Symbols
LCCP
NCBI Protein Information
angiomotin-like protein 2
UniProt Protein Name
Angiomotin-like protein 2
Protein Family
UniProt Gene Name
AMOTL2
UniProt Synonym Gene Names
KIAA0989; LCCP

NCBI Description

Angiomotin is a protein that binds angiostatin, a circulating inhibitor of the formation of new blood vessels (angiogenesis). Angiomotin mediates angiostatin inhibition of endothelial cell migration and tube formation in vitro. The protein encoded by this gene is related to angiomotin and is a member of the motin protein family. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

AMOTL2: Regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. Required for proper architecture of actin filaments. Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus. Participates in angiogenesis. May play a role in the polarity, proliferation and migration of endothelial cells. Selectively promotes FGF-induced MAPK activation through SRC. Belongs to the angiomotin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 3q22.2

Cellular Component: apical plasma membrane; bicellular tight junction; cytosol; recycling endosome

Molecular Function: identical protein binding; protein binding

Biological Process: Wnt signaling pathway

Research Articles on AMOTL2

Similar Products

Product Notes

The AMOTL2 amotl2 (Catalog #AAA9140976) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMOTL2 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AMOTL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the AMOTL2 amotl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMOTL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.