Immunohistochemistry (IHC)
(Immunohistochemistry of formalin-fixed, paraffin-embedded human prostate tissue at an antibody concentration of 5.0ug/ml using anti-AMH antibody )
Rabbit AMH Polyclonal Antibody | anti-AMH antibody
AMH antibody - middle region
Gene Names
AMH; MIF; MIS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
AMH; Polyclonal Antibody; AMH antibody - middle region; anti-AMH antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
Sequence Length
560
Applicable Applications for anti-AMH antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AMH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry of formalin-fixed, paraffin-embedded human prostate tissue at an antibody concentration of 5.0ug/ml using anti-AMH antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry of formalin-fixed, paraffin-embedded human prostate tissue at an antibody concentration of 5.0ug/ml using anti-AMH antibody )
Western Blot (WB)
(WB Suggested Anti-AMH Antibody Titration: 1 ug/mlPositive Control: Fetal Small Intestine cell lysate)
Western Blot (WB)
(WB Suggested Anti-AMH Antibody Titration: 1 ug/mlPositive Control: Fetal Small Intestine cell lysate)
Related Product Information for anti-AMH antibody
This is a rabbit polyclonal antibody against AMH. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-AMH antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60kDa
NCBI Official Full Name
muellerian-inhibiting factor preproprotein
NCBI Official Synonym Full Names
anti-Mullerian hormone
NCBI Official Symbol
AMH
NCBI Official Synonym Symbols
MIF; MIS
NCBI Protein Information
muellerian-inhibiting factor
Protein Family
NCBI Description
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2016]
Research Articles on AMH
Similar Products
Product Notes
The AMH (Catalog #AAA3211596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMH antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AMH can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the AMH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVDLRAERSV LIPETYQANN CQGVCGWPQS DRNPRYGNHV VLLLKMQARG. It is sometimes possible for the material contained within the vial of "AMH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
