Rabbit anti-Human HPGD Polyclonal Antibody | anti-HPGD antibody

HPGD (Hydroxyprostaglandin Dehydrogenase 15-(NAD), 15-PGDH, PGDH, PGDH1, SDR36C1) (Biotin)

Cat. Num. AAA6451082

• Gene Names: HPGD; PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: HPGD; Polyclonal Antibody; HPGD (Hydroxyprostaglandin Dehydrogenase 15-(NAD); 15-PGDH; PGDH; PGDH1; SDR36C1) (Biotin); Hydroxyprostaglandin Dehydrogenase 15-(NAD); SDR36C1; anti-HPGD antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human HPGD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HPGD antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HPGD (NP_000851.2, 1aa-266aa) full-length human protein.
• Immunogen Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HPGD expression in transfected 293T cell line by HPGD MaxPab polyclonal antibody.Lane 1: HPGD transfected lysate(29.00 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-HPGD antibody

This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-HPGD antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 31542939
• NCBI GeneID: 3248
• NCBI Accession #: NP_000851.2
• NCBI GenBank Nucleotide #: NM_000860.5
• UniProt Accession #: P15428; O00749; Q06F08; Q12998; B4DTA4; B4DU74; B4DV57; D3DP43; E7EV11
• Molecular Weight: 21,526 Da
• NCBI Official Full Name: 15-hydroxyprostaglandin dehydrogenase
• NCBI Official Synonym Full Names: hydroxyprostaglandin dehydrogenase 15-(NAD)
• NCBI Official Symbol: HPGD
• NCBI Official Synonym Symbols: PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1
• NCBI Protein Information: 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; prostaglandin dehydrogenase 1; short chain dehydrogenase/reductase family 36C, member 1
• UniProt Protein Name: 15-hydroxyprostaglandin dehydrogenase [NAD(+)]
• Protein Family: 15-hydroxyprostaglandin dehydrogenase
• UniProt Gene Name: HPGD
• UniProt Synonym Gene Names: PGDH1; 15-PGDH
• UniProt Entry Name: PGDH_HUMAN

NCBI Description

This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

HPGD: Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells. Defects in HPGD are the cause of hypertrophic osteoarthropathy, primary, autosomal recessive, type 1 (PHOAR1). A disease characterized by digital clubbing, periostosis, acroosteolysis, painful joint enlargement, and variable features of pachydermia that include thickened facial skin and a thickened scalp. Other developmental anomalies include delayed closure of the cranial sutures and congenital heart disease. Defects in HPGD are the cause of cranioosteoarthropathy (COA). A form of osterarthropathy characterized by swelling of the joints, digital clubbing, hyperhidrosis, delayed closure of the fontanels, periostosis, and variable patent ductus arteriosus. Pachydermia is not a prominent feature. Defects in HPGD are a cause of isolated congenital nail clubbing (ICNC); also called clubbing of digits or hereditary acropachy. ICNC is a rare genodermatosis characterized by enlargement of the nail plate and terminal segments of the fingers and toes, resulting from proliferation of the connective tissues between the nail matrix and the distal phalanx. It is usually symmetrical and bilateral (in some cases unilateral). In nail clubbing usually the distal end of the nail matrix is relatively high compared to the proximal end, while the nail plate is complete but its dimensions and diameter more or less vary in comparison to normal. There may be different fingers and toes involved to varying degrees. Some fingers or toes are spared, but the thumbs are almost always involved. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; EC 1.1.1.141; Oxidoreductase

Chromosomal Location of Human Ortholog: 4q34-q35

Cellular Component: basolateral plasma membrane; cytosol

Molecular Function: protein homodimerization activity; 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; catalytic activity; NAD binding; prostaglandin E receptor activity

Biological Process: ovulation; lipoxygenase pathway; transforming growth factor beta receptor signaling pathway; cyclooxygenase pathway; arachidonic acid metabolic process; female pregnancy; parturition; negative regulation of cell cycle; prostaglandin metabolic process

Disease: Digital Clubbing, Isolated Congenital; Hypertrophic Osteoarthropathy, Primary, Autosomal Recessive, 1