Immunohistochemistry (IHC)
(Immunohistochemistry with Kidney tissue at an antibody concentration of 5ug/ml using anti-AMACR antibody )
Rabbit AMACR Polyclonal Antibody | anti-AMACR antibody
AMACR antibody - C-terminal region
Gene Names
AMACR; RM; RACE; CBAS4; P504S; AMACRD
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
AMACR; Polyclonal Antibody; AMACR antibody - C-terminal region; anti-AMACR antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP
Sequence Length
382
Applicable Applications for anti-AMACR antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 77%; Pig: 85%; Rabbit: 82%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AMACR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Kidney tissue at an antibody concentration of 5ug/ml using anti-AMACR antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Kidney tissue at an antibody concentration of 5ug/ml using anti-AMACR antibody )
Western Blot (WB)
(Sample Type: Human 721_BAMACR antibody - C-terminal region validated by WB using 721_B cell lysate at 1.0ug/ml.AMACR is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(Sample Type: Human 721_BAMACR antibody - C-terminal region validated by WB using 721_B cell lysate at 1.0ug/ml.AMACR is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-AMACR antibody
This is a rabbit polyclonal antibody against AMACR. It was validated on Western Blot
Target Description: This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Target Description: This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Product Categories/Family for anti-AMACR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
alpha-methylacyl-CoA racemase isoform 1
NCBI Official Synonym Full Names
alpha-methylacyl-CoA racemase
NCBI Official Symbol
AMACR
NCBI Official Synonym Symbols
RM; RACE; CBAS4; P504S; AMACRD
NCBI Protein Information
alpha-methylacyl-CoA racemase
UniProt Protein Name
Alpha-methylacyl-CoA racemase
Protein Family
UniProt Gene Name
AMACR
UniProt Entry Name
AMACR_HUMAN
NCBI Description
This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011]
Research Articles on AMACR
Similar Products
Product Notes
The AMACR amacr (Catalog #AAA3214967) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMACR antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AMACR can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the AMACR amacr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFDGTDACVT PVLTFEEVVH HDHNKERGSF ITSEEQDVSP RPAPLLLNTP. It is sometimes possible for the material contained within the vial of "AMACR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
