Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AKR1C1 rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.)

Rabbit anti-Human AKR1C1 Polyclonal Antibody | anti-AKR1C1 antibody

AKR1C1 (Aldo-keto Reductase Family 1 Member C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, Chlordecone Reductase Homolog HAKRC, Dihydrodiol Dehydrogenase 1/2, DD1/DD2, High-affinity Hepatic Bile Acid-binding Protein, HBAB, Indanol Dehydrogenase,

Gene Names
AKR1C1; C9; DD1; DDH; DDH1; H-37; HBAB; MBAB; HAKRC; DD1/DD2; 2-ALPHA-HSD; 20-ALPHA-HSD
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKR1C1; Polyclonal Antibody; AKR1C1 (Aldo-keto Reductase Family 1 Member C1; 20-alpha-hydroxysteroid Dehydrogenase; 20-alpha-HSD; Chlordecone Reductase Homolog HAKRC; Dihydrodiol Dehydrogenase 1/2; DD1/DD2; High-affinity Hepatic Bile Acid-binding Protein; HBAB; Indanol Dehydrogenase; ; anti-AKR1C1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AKR1C1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-AKR1C1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AKR1C1, aa1-323 (NP_001344.2).
Immunogen Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AKR1C1 rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.)

Western Blot (WB) (AKR1C1 rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of AKR1C1 expression in transfected 293T cell line by AKR1C1 polyclonal antibody. Lane 1: AKR1C1 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AKR1C1 expression in transfected 293T cell line by AKR1C1 polyclonal antibody. Lane 1: AKR1C1 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AKR1C1 antibody
The human aldo-keto reductases 1C1 and 1C3 (AKR1C1 and AKR1C3) have major roles in pre receptor regulation of progesterone action. They can both convert progesterone to the less potent efficiencies. AKR1C1 and AKR1C3 also act as 3-ketosteroid reductase, and as such they can convert the most potent androgen 5alpha-DHT into 3beta-andorstandiol, which is an estrogen receptor beta ligand, and into the inactive androgen 3alpha-androstnionl, respectively.
Product Categories/Family for anti-AKR1C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,788 Da
NCBI Official Full Name
aldo-keto reductase family 1 member C1
NCBI Official Synonym Full Names
aldo-keto reductase family 1, member C1
NCBI Official Symbol
AKR1C1
NCBI Official Synonym Symbols
C9; DD1; DDH; DDH1; H-37; HBAB; MBAB; HAKRC; DD1/DD2; 2-ALPHA-HSD; 20-ALPHA-HSD
NCBI Protein Information
aldo-keto reductase family 1 member C1; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; aldo-keto reductase C; chlordecone reductase homolog HAKRC; dihydrodiol dehydrogenase 1; dihydrodiol dehydrogenase 1/2; dihydrodiol dehyd

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008]

Research Articles on AKR1C1

Similar Products

Product Notes

The AKR1C1 (Catalog #AAA6369312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1C1 (Aldo-keto Reductase Family 1 Member C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, Chlordecone Reductase Homolog HAKRC, Dihydrodiol Dehydrogenase 1/2, DD1/DD2, High-affinity Hepatic Bile Acid-binding Protein, HBAB, Indanol Dehydrogenase, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1C1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1C1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.