Rabbit anti-Human AKR1C1 Polyclonal Antibody | anti-AKR1C1 antibody

AKR1C1 (Aldo-keto Reductase Family 1 Member C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, Chlordecone Reductase Homolog HAKRC, Dihydrodiol Dehydrogenase 1/2, DD1/DD2, High-affinity Hepatic Bile Acid-binding Protein, HBAB, Indanol Dehydrogenase,

Cat. Num. AAA6369318

• Gene Names: AKR1C1; C9; DD1; DDH; DDH1; H-37; HBAB; MBAB; HAKRC; DD1/DD2; 2-ALPHA-HSD; 20-ALPHA-HSD
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AKR1C1; Polyclonal Antibody; AKR1C1 (Aldo-keto Reductase Family 1 Member C1; 20-alpha-hydroxysteroid Dehydrogenase; 20-alpha-HSD; Chlordecone Reductase Homolog HAKRC; Dihydrodiol Dehydrogenase 1/2; DD1/DD2; High-affinity Hepatic Bile Acid-binding Protein; HBAB; Indanol Dehydrogenase; ; anti-AKR1C1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AKR1C1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-AKR1C1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human AKR1C1, aa1-323 (NP_001344.2).
• Immunogen Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(AKR1C1 rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of AKR1C1 expression in transfected 293T cell line by AKR1C1 polyclonal antibody. Lane 1: AKR1C1 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-AKR1C1 antibody

The human aldo-keto reductases 1C1 and 1C3 (AKR1C1 and AKR1C3) have major roles in pre receptor regulation of progesterone action. They can both convert progesterone to the less potent efficiencies. AKR1C1 and AKR1C3 also act as 3-ketosteroid reductase, and as such they can convert the most potent androgen 5alpha-DHT into 3beta-andorstandiol, which is an estrogen receptor beta ligand, and into the inactive androgen 3alpha-androstnionl, respectively.

Product Categories/Family for anti-AKR1C1 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 5453543
• NCBI GeneID: 1645
• NCBI Accession #: NP_001344.2
• NCBI GenBank Nucleotide #: NM_001353.5
• Molecular Weight: 36,788 Da
• NCBI Official Full Name: aldo-keto reductase family 1 member C1
• NCBI Official Synonym Full Names: aldo-keto reductase family 1, member C1
• NCBI Official Symbol: AKR1C1
• NCBI Official Synonym Symbols: C9; DD1; DDH; DDH1; H-37; HBAB; MBAB; HAKRC; DD1/DD2; 2-ALPHA-HSD; 20-ALPHA-HSD
• NCBI Protein Information: aldo-keto reductase family 1 member C1; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; aldo-keto reductase C; chlordecone reductase homolog HAKRC; dihydrodiol dehydrogenase 1; dihydrodiol dehydrogenase 1/2; dihydrodiol dehyd
• Protein Family: Aldo-keto reductase family

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008]