Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (46.86kD).)

Mouse anti-Human PMVK Monoclonal Antibody | anti-PMVK antibody

PMVK (Phosphomevalonate Kinase, hPMK, HUMPMKI, PMK, PMKA, PMKase, PMKASE, PMKI) (Biotin)

Gene Names
PMVK; PMK; PMKA; PMKASE; POROK1; HUMPMKI
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PMVK; Monoclonal Antibody; PMVK (Phosphomevalonate Kinase; hPMK; HUMPMKI; PMK; PMKA; PMKase; PMKASE; PMKI) (Biotin); anti-PMVK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B8
Specificity
Recognizes human PMVK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1225
Applicable Applications for anti-PMVK antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-192 from PMVK (AAH07694) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.86kD).)

Western Blot (WB) (Western Blot detection against Immunogen (46.86kD).)

Western Blot (WB)

(Western Blot analysis of PMVK expression in transfected 293T cell line by PMVK monoclonal antibody Lane 1: PMVK transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PMVK expression in transfected 293T cell line by PMVK monoclonal antibody Lane 1: PMVK transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PMVK transfected lysate using PMVK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PMVK rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PMVK transfected lysate using PMVK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PMVK rabbit polyclonal antibody.)
Related Product Information for anti-PMVK antibody
PMVK is a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate as the fifth reaction of the cholesterol biosynthetic pathway. The deduced 192aa PMVK protein has a calculated molecular mass of about 22kD. It contains a C-terminal peroxisomal targeting sequence, and a single methionine is removed from the N terminus upon maturation of the protein. Expression is highest in heart and skeletal muscle, with slightly lower levels in liver, kidney, and pancreas, and low but detectable levels in brain, lung, and placenta.
Product Categories/Family for anti-PMVK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens phosphomevalonate kinase, mRNA
NCBI Official Synonym Full Names
phosphomevalonate kinase
NCBI Official Symbol
PMVK
NCBI Official Synonym Symbols
PMK; PMKA; PMKASE; POROK1; HUMPMKI
NCBI Protein Information
phosphomevalonate kinase

NCBI Description

This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate to mevalonate 5-diphosphate, which is the fifth step in the mevalonate pathway of isoprenoid biosynthesis. Mutations in this gene are linked to certain types of porokeratosis including disseminated superficial porokeratosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]

Research Articles on PMVK

Similar Products

Product Notes

The PMVK (Catalog #AAA6143635) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PMVK (Phosphomevalonate Kinase, hPMK, HUMPMKI, PMK, PMKA, PMKase, PMKASE, PMKI) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PMVK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PMVK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PMVK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.