Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AKR1B1 expression in transfected 293T cell line by AKR1B1 MaxPab polyclonal antibody.Lane 1: AKR1B1 transfected lysate(34.76 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human AKR1B1 Polyclonal Antibody | anti-AKR1B1 antibody

AKR1B1 (aldo-keto Reductase Family 1, Member B1 (aldose Reductase), ADR, ALDR1, ALR2, AR, MGC1804) (Biotin)

Gene Names
AKR1B1; AR; ADR; ALR2; ALDR1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
AKR1B1; Polyclonal Antibody; AKR1B1 (aldo-keto Reductase Family 1; Member B1 (aldose Reductase); ADR; ALDR1; ALR2; AR; MGC1804) (Biotin); aldo-keto Reductase Family 1; MGC1804; anti-AKR1B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AKR1B1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
316
Applicable Applications for anti-AKR1B1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AKR1B1 (AAH00260.1, 1aa-316aa) full-length human protein.
Immunogen Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AKR1B1 expression in transfected 293T cell line by AKR1B1 MaxPab polyclonal antibody.Lane 1: AKR1B1 transfected lysate(34.76 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AKR1B1 expression in transfected 293T cell line by AKR1B1 MaxPab polyclonal antibody.Lane 1: AKR1B1 transfected lysate(34.76 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-AKR1B1 antibody
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq]
Product Categories/Family for anti-AKR1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
231
NCBI Official Full Name
Aldo-keto reductase family 1, member B1 (aldose reductase)
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member B
NCBI Official Symbol
AKR1B1
NCBI Official Synonym Symbols
AR; ADR; ALR2; ALDR1
NCBI Protein Information
aldo-keto reductase family 1 member B1
Protein Family

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009]

Research Articles on AKR1B1

Similar Products

Product Notes

The AKR1B1 (Catalog #AAA6450466) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1B1 (aldo-keto Reductase Family 1, Member B1 (aldose Reductase), ADR, ALDR1, ALR2, AR, MGC1804) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1B1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.