Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AK1 rabbit polyclonal antibody. Western Blot analysis of AK1 expression in NIH/3T3.)

Rabbit anti-Human, Mouse AK1 Polyclonal Antibody | anti-AK1 antibody

AK1 (Adenylate Kinase Isoenzyme 1, AK 1, ATP-AMP Transphosphorylase 1, Myokinase) (AP)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AK1; Polyclonal Antibody; AK1 (Adenylate Kinase Isoenzyme 1; AK 1; ATP-AMP Transphosphorylase 1; Myokinase) (AP); anti-AK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AK1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-AK1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AK1, aa1-194 (NP_000467.1).
Immunogen Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(AK1 rabbit polyclonal antibody. Western Blot analysis of AK1 expression in NIH/3T3.)

Western Blot (WB) (AK1 rabbit polyclonal antibody. Western Blot analysis of AK1 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 polyclonal antibody. Lane 1: AK1 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 polyclonal antibody. Lane 1: AK1 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AK1 antibody
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.
Product Categories/Family for anti-AK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
203
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,635 Da
NCBI Official Full Name
adenylate kinase isoenzyme 1
NCBI Official Synonym Full Names
adenylate kinase 1
NCBI Official Symbol
AK1
NCBI Protein Information
adenylate kinase isoenzyme 1; AK 1; myokinase; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase 1; adenylate monophosphate kinase
UniProt Protein Name
Adenylate kinase isoenzyme 1
Protein Family
UniProt Gene Name
AK1
UniProt Synonym Gene Names
AK 1
UniProt Entry Name
KAD1_HUMAN

NCBI Description

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq, Jul 2008]

Uniprot Description

AK1: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Defects in AK1 are the cause of hemolytic anemia due to adenylate kinase deficiency (HAAKD). Belongs to the adenylate kinase family.

Protein type: Kinase, other; EC 2.7.4.3; EC 2.7.4.6; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: cytoplasm; plasma membrane; cytosol; outer dense fiber

Molecular Function: nucleoside diphosphate kinase activity; adenylate kinase activity; ATP binding

Biological Process: ATP metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleoside triphosphate biosynthetic process; nucleoside diphosphate phosphorylation; ADP biosynthetic process; AMP metabolic process; cell cycle arrest

Disease: Adenylate Kinase Deficiency, Hemolytic Anemia Due To

Research Articles on AK1

Similar Products

Product Notes

The AK1 ak1 (Catalog #AAA6369198) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AK1 (Adenylate Kinase Isoenzyme 1, AK 1, ATP-AMP Transphosphorylase 1, Myokinase) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AK1 ak1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.