Rabbit anti-Human, Mouse AK1 Polyclonal Antibody | anti-AK1 antibody

AK1 (Adenylate Kinase Isoenzyme 1, AK 1, ATP-AMP Transphosphorylase 1, Myokinase) (HRP)

Cat. Num. AAA6369202

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AK1; Polyclonal Antibody; AK1 (Adenylate Kinase Isoenzyme 1; AK 1; ATP-AMP Transphosphorylase 1; Myokinase) (HRP); anti-AK1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AK1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-AK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human AK1, aa1-194 (NP_000467.1).
• Immunogen Sequence: MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AK1 rabbit polyclonal antibody. Western Blot analysis of AK1 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 polyclonal antibody. Lane 1: AK1 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-AK1 antibody

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Product Categories/Family for anti-AK1 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 4502011
• NCBI GeneID: 203
• NCBI Accession #: NP_000467.1
• NCBI GenBank Nucleotide #: NM_000476.1
• UniProt Accession #: P00568; Q9BVK9; Q9UQC7
• Molecular Weight: 21,635 Da
• NCBI Official Full Name: adenylate kinase isoenzyme 1
• NCBI Official Synonym Full Names: adenylate kinase 1
• NCBI Official Symbol: AK1
• NCBI Protein Information: adenylate kinase isoenzyme 1; AK 1; myokinase; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase 1; adenylate monophosphate kinase
• UniProt Protein Name: Adenylate kinase isoenzyme 1
• Protein Family: Adenylate kinase
• UniProt Gene Name: AK1
• UniProt Synonym Gene Names: AK 1
• UniProt Entry Name: KAD1_HUMAN

NCBI Description

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq, Jul 2008]

Uniprot Description

AK1: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Defects in AK1 are the cause of hemolytic anemia due to adenylate kinase deficiency (HAAKD). Belongs to the adenylate kinase family.

Protein type: Kinase, other; EC 2.7.4.3; EC 2.7.4.6; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: cytoplasm; plasma membrane; cytosol; outer dense fiber

Molecular Function: nucleoside diphosphate kinase activity; adenylate kinase activity; ATP binding

Biological Process: ATP metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleoside triphosphate biosynthetic process; nucleoside diphosphate phosphorylation; ADP biosynthetic process; AMP metabolic process; cell cycle arrest

Disease: Adenylate Kinase Deficiency, Hemolytic Anemia Due To