Rabbit anti-Mouse, Rat AGPAT5 Polyclonal Antibody | anti-AGPAT5 antibody
AGPAT5 Polyclonal Antibody
Gene Names
AGPAT5; LPAATE; 1AGPAT5
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
AGPAT5; Polyclonal Antibody; AGPAT5 Polyclonal Antibody; 1AGPAT5; LPAATE; anti-AGPAT5 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KEGLKWLPLYGCYFAQHGGIYVKRSAKFNEKEMRNKLQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDCMKNYLDAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVNSKLSIKK
Sequence Length
364
Applicable Applications for anti-AGPAT5 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human AGPAT5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum membrane, Mitochondrion, Multi-pass membrane protein, Nucleus envelope
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-AGPAT5 antibody
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. A pseudogene of this gene is present on the Y chromosome.
Product Categories/Family for anti-AGPAT5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42kDa
NCBI Official Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 5
NCBI Official Symbol
AGPAT5
NCBI Official Synonym Symbols
LPAATE; 1AGPAT5
NCBI Protein Information
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
UniProt Protein Name
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
Protein Family
UniProt Gene Name
AGPAT5
UniProt Synonym Gene Names
1-AGP acyltransferase 5; 1-AGPAT 5; LPAAT-epsilon
NCBI Description
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. A pseudogene of this gene is present on the Y chromosome. [provided by RefSeq, Aug 2014]
Uniprot Description
Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Acts on LPA containing saturated or unsaturated fatty acids C15:0-C20:4 at the sn-1 position using C18:1-CoA as the acyl donor. Also acts on lysophosphatidylethanolamine using oleoyl-CoA, but not arachidonoyl-CoA, and lysophosphatidylinositol using arachidonoyl-CoA, but not oleoyl-CoA. Activity toward lysophosphatidylglycerol not detectable.
Research Articles on AGPAT5
1. enzymatic properties, tissue distribution, and subcellular localization of human AGPAT3 and AGPAT5
Similar Products
Product Notes
The AGPAT5 agpat5 (Catalog #AAA9133000) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGPAT5 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AGPAT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the AGPAT5 agpat5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KEGLKWLPLY GCYFAQHGGI YVKRSAKFNE KEMRNKLQSY VDAGTPMYLV IFPEGTRYNP EQTKVLSASQ AFAAQRGLAV LKHVLTPRIK ATHVAFDCMK NYLDAIYDVT VVYEGKDDGG QRRESPTMTE FLCKECPKIH IHIDRIDKKD VPEEQEHMRR WLHERFEIKD KMLIEFYESP DPERRKRFPG KSVNSKLSIK K. It is sometimes possible for the material contained within the vial of "AGPAT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
