Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLCB antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)

Rabbit anti-Human AGPAT2 Polyclonal Antibody | anti-AGPAT2 antibody

AGPAT2 Antibody - middle region

Gene Names
AGPAT2; BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AGPAT2; Polyclonal Antibody; AGPAT2 Antibody - middle region; anti-AGPAT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKK
Sequence Length
278
Applicable Applications for anti-AGPAT2 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-AGPAT2 antibody is: synthetic peptide directed towards the middle region of Human PLCB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLCB antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)

Western Blot (WB) (WB Suggested Anti-PLCB antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)
Related Product Information for anti-AGPAT2 antibody
This is a rabbit polyclonal antibody against PLCB. It was validated on Western Blot

Target Description: This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform a
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 2
NCBI Official Symbol
AGPAT2
NCBI Official Synonym Symbols
BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta
NCBI Protein Information
1-acyl-sn-glycerol-3-phosphate acyltransferase beta
UniProt Protein Name
1-acyl-sn-glycerol-3-phosphate acyltransferase beta
UniProt Gene Name
AGPAT2
UniProt Synonym Gene Names
1-AGP acyltransferase 2; 1-AGPAT 2; LPAAT-beta
UniProt Entry Name
PLCB_HUMAN

NCBI Description

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.

Catalytic activity: Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.

Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed predominantly in heart and liver.

Domain: The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate

By similarity.

Involvement in disease: Congenital generalized lipodystrophy 1 (CGL1) [MIM:608594]: An autosomal recessive disorder characterized by a near complete absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10

Sequence similarities: Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Research Articles on AGPAT2

Similar Products

Product Notes

The AGPAT2 agpat2 (Catalog #AAA3219646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGPAT2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AGPAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGPAT2 agpat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVFFINRQRS STAMTVMADL GERMVRENLK VWIYPEGTRN DNGDLLPFKK. It is sometimes possible for the material contained within the vial of "AGPAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.