Western Blot (WB)
(Host: RabbitTarget Name: AGPAT2Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human, Pig AGPAT2 Polyclonal Antibody | anti-AGPAT2 antibody
AGPAT2 antibody - C-terminal region
Gene Names
AGPAT2; BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta
Reactivity
Human, Pig
Applications
Western Blot
Purity
Protein A purified
Synonyms
AGPAT2; Polyclonal Antibody; AGPAT2 antibody - C-terminal region; anti-AGPAT2 antibody
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
Sequence Length
246
Applicable Applications for anti-AGPAT2 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AGPAT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: AGPAT2Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: AGPAT2Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-AGPAT2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-AGPAT2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-AGPAT2 antibody
This is a rabbit polyclonal antibody against AGPAT2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Target Description: AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-AGPAT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27kDa
NCBI Official Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform b
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 2
NCBI Official Symbol
AGPAT2
NCBI Official Synonym Symbols
BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta
NCBI Protein Information
1-acyl-sn-glycerol-3-phosphate acyltransferase beta
Protein Family
NCBI Description
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Research Articles on AGPAT2
Similar Products
Product Notes
The AGPAT2 (Catalog #AAA3207465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGPAT2 antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's AGPAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGPAT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEAIPTSGLT AADVPALVDT CHRAMRTTFL HISKTPQENG ATAGSGVQPA. It is sometimes possible for the material contained within the vial of "AGPAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
