Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AGA AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Rabbit AGA Polyclonal Antibody | anti-AGA antibody

AGA antibody - middle region

Gene Names
AGA; GA; AGU; ASRG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGA; Polyclonal Antibody; AGA antibody - middle region; anti-AGA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGI
Sequence Length
336
Applicable Applications for anti-AGA antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Pig: 86%; Rat: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AGA AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-AGA AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-AGA antibody
This is a rabbit polyclonal antibody against AGA. It was validated on Western Blot

Target Description: Aspartylglucosaminidase is involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. The lysosomal storage disease aspartylglycosaminuria is caused by a deficiency in the AGA enzyme.
Product Categories/Family for anti-AGA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
175
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase isoform 2
NCBI Official Synonym Full Names
aspartylglucosaminidase
NCBI Official Symbol
AGA
NCBI Official Synonym Symbols
GA; AGU; ASRG
NCBI Protein Information
N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase
UniProt Protein Name
N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase
Protein Family
UniProt Gene Name
AGA
UniProt Entry Name
ASPG_HUMAN

NCBI Description

This gene encodes a member of the N-terminal nucleophile (Ntn) hydrolase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta chains that comprise the mature enzyme. This enzyme is involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. Mutations in this gene are associated with the lysosomal storage disease aspartylglycosaminuria that results in progressive neurodegeneration. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is subject to proteolytic processing. [provided by RefSeq, Nov 2015]

Uniprot Description

AGA: a catabolic enzyme, aspartylglucosaminidase is involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. The lysosomal storage disease aspartylglycosaminuria is caused by a deficiency in the AGA enzyme.

Protein type: Glycan Metabolism - other glycan degradation; EC 3.5.1.26; Hydrolase

Chromosomal Location of Human Ortholog: 4q34.3

Cellular Component: endoplasmic reticulum; lysosome

Molecular Function: peptidase activity; protein self-association; N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity

Biological Process: protein deglycosylation; protein maturation; proteolysis

Disease: Aspartylglucosaminuria

Research Articles on AGA

Similar Products

Product Notes

The AGA aga (Catalog #AAA3215059) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGA antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AGA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGA aga for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SMGFINEDLS TTASQALHSD WLARNCQPNY WRNVIPDPSK YCGPYKPPGI. It is sometimes possible for the material contained within the vial of "AGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.