Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PGAM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Rabbit PGAM2 Polyclonal Antibody | anti-PGAM2 antibody

PGAM2 antibody - middle region

Gene Names
PGAM2; GSD10; PGAMM; PGAM-M
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PGAM2; Polyclonal Antibody; PGAM2 antibody - middle region; anti-PGAM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDT
Sequence Length
253
Applicable Applications for anti-PGAM2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PGAM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PGAM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-PGAM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Related Product Information for anti-PGAM2 antibody
This is a rabbit polyclonal antibody against PGAM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Product Categories/Family for anti-PGAM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
phosphoglycerate mutase 2
NCBI Official Synonym Full Names
phosphoglycerate mutase 2
NCBI Official Symbol
PGAM2
NCBI Official Synonym Symbols
GSD10; PGAMM; PGAM-M
NCBI Protein Information
phosphoglycerate mutase 2
UniProt Protein Name
Phosphoglycerate mutase 2
Protein Family
UniProt Gene Name
PGAM2
UniProt Synonym Gene Names
PGAMM; PGAM-M
UniProt Entry Name
PGAM2_HUMAN

NCBI Description

Phosphoglycerate mutase (PGAM) catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The PGAM is a dimeric enzyme containing, in different tissues, different proportions of a slow-migrating muscle (MM) isozyme, a fast-migrating brain (BB) isozyme, and a hybrid form (MB). This gene encodes muscle-specific PGAM subunit. Mutations in this gene cause muscle phosphoglycerate mutase eficiency, also known as glycogen storage disease X. [provided by RefSeq, Sep 2009]

Uniprot Description

PGAM2: Interconversion of 3- and 2-phosphoglycerate with 2,3- bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity. Defects in PGAM2 are the cause of glycogen storage disease type 10 (GSD10). A metabolic disorder characterized by myoglobinuria, increased serum creatine kinase levels, decreased phosphoglycerate mutase activity, myalgia, muscle pain, muscle cramps and excercise intolerance. Belongs to the phosphoglycerate mutase family. BPG- dependent PGAM subfamily.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Phosphatase (non-protein); Isomerase; EC 5.4.2.11; EC 5.4.2.4; EC 3.1.3.13

Chromosomal Location of Human Ortholog: 7p13-p12

Cellular Component: nucleus; cytosol

Molecular Function: phosphoglycerate mutase activity; bisphosphoglycerate mutase activity; bisphosphoglycerate phosphatase activity; cofactor binding; 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase activity

Biological Process: response to mercury ion; striated muscle contraction; glycolysis; dephosphorylation; carbohydrate metabolic process; glucose metabolic process; pathogenesis; spermatogenesis; gluconeogenesis

Disease: Glycogen Storage Disease X

Research Articles on PGAM2

Similar Products

Product Notes

The PGAM2 pgam2 (Catalog #AAA3208872) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGAM2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PGAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PGAM2 pgam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQVKIWRRSF DIPPPPMDEK HPYYNSISKE RRYAGLKPGE LPTCESLKDT. It is sometimes possible for the material contained within the vial of "PGAM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.