Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADSLSample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ADSL Polyclonal Antibody | anti-ADSL antibody

ADSL Antibody - middle region

Gene Names
ADSL; ASL; AMPS; ASASE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADSL; Polyclonal Antibody; ADSL Antibody - middle region; anti-ADSL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLAR
Sequence Length
484
Applicable Applications for anti-ADSL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADSL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADSLSample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADSLSample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADSL antibody
The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-ADSL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
158
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
adenylosuccinate lyase isoform a
NCBI Official Synonym Full Names
adenylosuccinate lyase
NCBI Official Symbol
ADSL
NCBI Official Synonym Symbols
ASL; AMPS; ASASE
NCBI Protein Information
adenylosuccinate lyase
UniProt Protein Name
Adenylosuccinate lyase
Protein Family
UniProt Gene Name
ADSL
UniProt Synonym Gene Names
AMPS; ASL; ASase
UniProt Entry Name
PUR8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

ADSL: Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency). ADSL deficiency is an autosomal recessive disorder characterized by the accumulation in the body fluids of succinylaminoimidazole-carboxamide riboside (SAICA-riboside) and succinyladenosine (S-Ado). Most children display marked psychomotor delay, often accompanied by epilepsy or autistic features, or both, although some patients may be less profoundly retarded. Occasionally, growth retardation and muscular wasting are also present. Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.3.2.2; Nucleotide Metabolism - purine; Lyase; Amino Acid Metabolism - alanine, aspartate and glutamate

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytosol

Molecular Function: adenylosuccinate lyase activity

Biological Process: AMP biosynthetic process; purine ribonucleoside monophosphate biosynthetic process; metabolic process; nucleobase, nucleoside and nucleotide metabolic process; purine nucleotide biosynthetic process; protein tetramerization; purine base metabolic process; 'de novo' IMP biosynthetic process

Disease: Adenylosuccinase Deficiency

Research Articles on ADSL

Similar Products

Product Notes

The ADSL adsl (Catalog #AAA3222414) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADSL Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADSL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADSL adsl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASVHKICTDI RLLANLKEME EPFEKQQIGS SAMPYKRNPM RSERCCSLAR. It is sometimes possible for the material contained within the vial of "ADSL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.