Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADRB1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit ADRB1 Polyclonal Antibody | anti-ADRB1 antibody

ADRB1 antibody - middle region

Gene Names
ADRB1; RHR; B1AR; ADRB1R; BETA1AR
Reactivity
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADRB1; Polyclonal Antibody; ADRB1 antibody - middle region; anti-ADRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Sequence Length
477
Applicable Applications for anti-ADRB1 antibody
Western Blot (WB)
Homology
Dog: 87%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADRB1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRB1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRB1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRB1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRB1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRB1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRB1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRB1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ADRB1 AntibodyPositive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20ug HepG2 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Kathleen Gabrielson)

Western Blot (WB) (WB Suggested Anti-ADRB1 AntibodyPositive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20ug HepG2 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Kathleen Gabrielson)

Western Blot (WB)

(WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-ADRB1 antibody
This is a rabbit polyclonal antibody against ADRB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
153
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
beta-1 adrenergic receptor
NCBI Official Synonym Full Names
adrenoceptor beta 1
NCBI Official Symbol
ADRB1
NCBI Official Synonym Symbols
RHR; B1AR; ADRB1R; BETA1AR
NCBI Protein Information
beta-1 adrenergic receptor
UniProt Protein Name
Beta-1 adrenergic receptor
UniProt Gene Name
ADRB1
UniProt Synonym Gene Names
ADRB1R; B1AR; Beta-1 adrenoceptor
UniProt Entry Name
ADRB1_HUMAN

NCBI Description

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. [provided by RefSeq, Jul 2008]

Uniprot Description

ADRB1: a GPCR-coupled 7 transmembrane receptor that binds epinephrine and norepinephrine with approximately equal affinity. Mediates the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Interacts with PIST and PSD-95. Localized at the plasma membrane and in the Golgi upon PIST overexpression. Homologous desensitization of the receptor is mediated by its phosphorylation by beta-adrenergic receptor kinase.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q25.3

Cellular Component: integral to plasma membrane; early endosome; plasma membrane; nucleus

Molecular Function: protein binding; protein heterodimerization activity; receptor signaling protein activity; dopamine binding; drug binding; norepinephrine binding; epinephrine binding; beta-adrenergic receptor activity; alpha-2A adrenergic receptor binding; Ras guanyl-nucleotide exchange factor activity; beta1-adrenergic receptor activity; PDZ domain binding

Biological Process: fear response; diet induced thermogenesis; wound healing; positive regulation of apoptosis; apoptosis; lipid homeostasis; positive regulation of systemic arterial blood pressure; sensory perception of pain; positive regulation of saliva secretion; Rho protein signal transduction; regulation of inhibitory postsynaptic membrane potential; negative regulation of smooth muscle contraction; positive regulation of cAMP biosynthetic process; aging; glycogen catabolic process; negative regulation of multicellular organism growth; adenylate cyclase activation; regulation of calcium ion transport; memory; positive regulation of the force of heart contraction by norepinephrine; protein localization in organelle; heat generation; brown fat cell differentiation; response to cold; positive regulation of heart rate by epinephrine-norepinephrine; norepinephrine-epinephrine vasodilation involved in regulation of systemic arterial blood pressure

Disease: Resting Heart Rate, Variation In

Research Articles on ADRB1

Similar Products

Product Notes

The ADRB1 adrb1 (Catalog #AAA3203181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADRB1 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADRB1 adrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTVWAISALV SFLPILMHWW RAESDEARRC YNDPKCCDFV TNRAYAIASS. It is sometimes possible for the material contained within the vial of "ADRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.