Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADORA2ASample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ADORA2A Polyclonal Antibody | anti-ADORA2A antibody

ADORA2A Antibody - middle region

Gene Names
Adora2a; A2aR; A2AAR; AA2AR; ARA2A
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADORA2A; Polyclonal Antibody; ADORA2A Antibody - middle region; anti-ADORA2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFIYAYRIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQV
Sequence Length
410
Applicable Applications for anti-ADORA2A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ADORA2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADORA2ASample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADORA2ASample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADORA2A antibody
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
adenosine receptor A2a
NCBI Official Synonym Full Names
adenosine A2a receptor
NCBI Official Symbol
Adora2a
NCBI Official Synonym Symbols
A2aR; A2AAR; AA2AR; ARA2A
NCBI Protein Information
adenosine receptor A2a
UniProt Protein Name
Adenosine receptor A2a
Protein Family
UniProt Gene Name
Adora2a
UniProt Entry Name
AA2AR_MOUSE

Uniprot Description

ADORA2A: one of several receptor subtypes for adenosine. A G-protein coupled receptor. Activation is mediated by G proteins which activate adenylyl cyclase. Abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Cellular Component: integral to plasma membrane; postsynaptic density; dendrite; integral to membrane; intermediate filament; endomembrane system; axolemma; presynaptic membrane; asymmetric synapse; postsynaptic membrane; membrane; cell soma; axon; presynaptic active zone; plasma membrane

Molecular Function: G-protein coupled receptor activity; identical protein binding; signal transducer activity; enzyme binding; protein heterodimerization activity; type 5 metabotropic glutamate receptor binding; alpha-actinin binding; adenosine receptor activity, G-protein coupled

Biological Process: response to alkaloid; positive regulation of circadian sleep/wake cycle, sleep; synaptic transmission, dopaminergic; prepulse inhibition; positive regulation of glutamate secretion; regulation of synaptic plasticity; locomotory behavior; negative regulation of caspase activity; signal transduction; vasodilation; G-protein signaling, adenylate cyclase activating pathway; positive regulation of synaptic transmission, glutamatergic; synaptic transmission, cholinergic; response to caffeine; regulation of inhibitory postsynaptic membrane potential; negative regulation of cell proliferation; negative regulation of alpha-beta T cell activation; negative regulation of locomotion; regulation of transcription, DNA-dependent; regulation of mitochondrial membrane potential; positive regulation of cAMP biosynthetic process; protein kinase C activation; negative regulation of neuron apoptosis; adenosine receptor signaling pathway; positive regulation of acetylcholine secretion; synaptic transmission, glutamatergic; eating behavior; response to amphetamine; positive regulation of synaptic transmission, GABAergic; regulation of calcium ion transport; regulation of norepinephrine secretion; membrane depolarization; G-protein coupled receptor protein signaling pathway; positive regulation of protein secretion; negative regulation of inflammatory response; negative regulation of vascular permeability; negative regulation of protein kinase activity; regulation of excitatory postsynaptic membrane potential; astrocyte activation; neurite morphogenesis

Research Articles on ADORA2A

Similar Products

Product Notes

The ADORA2A adora2a (Catalog #AAA3223703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADORA2A Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ADORA2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADORA2A adora2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFIYAYRIRE FRQTFRKIIR THVLRRQEPF RAGGSSAWAL AAHSTEGEQV. It is sometimes possible for the material contained within the vial of "ADORA2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.