Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADCY10Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ADCY10 Polyclonal Antibody | anti-ADCY10 antibody

ADCY10 Antibody - N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADCY10; Polyclonal Antibody; ADCY10 Antibody - N-terminal region; anti-ADCY10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDA
Sequence Length
1610
Applicable Applications for anti-ADCY10 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADCY10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADCY10Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADCY10Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADCY10 antibody
adenylate cyclase 10 (soluble)

Target Description: The protein encoded by this gene belongs to a distinct class of adenylyl cyclases that is soluble and insensitive to G protein or forskolin regulation. Activity of this protein is regulated by bicarbonate. Variation at this gene has been observed in patients with absorptive hypercalciuria. Alternatively spliced transcript variants encoding different isoforms have been observed. There is a pseudogene of this gene on chromosome 6.
Product Categories/Family for anti-ADCY10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
177 kDa
NCBI Official Full Name
adenylate cyclase type 10 isoform 1
UniProt Protein Name
Adenylate cyclase type 10
Protein Family
UniProt Gene Name
ADCY10
UniProt Synonym Gene Names
SAC; hsAC; sAC
UniProt Entry Name
ADCYA_HUMAN

Uniprot Description

SAC: Soluble adenylyl cyclase that has a critical role in mammalian spermatogenesis. Produces the cAMP which mediates in part the cAMP-responsive nuclear factors indispensable for maturation of sperm in the epididymis. Induces capacitation, the maturational process that sperm undergo prior to fertilization. May be the bicarbonate sensor. Involved in ciliary beat regulation. Genetic variations in ADCY10 are a cause of susceptibility to hypercalciuria absorptive type 2 (HCA2). Absorptive hypercalciuria is a common type of hypercalciuria, a condition characterized by excessive urinary calcium excretion. Absorptive hypercalciuria is due to gastrointestinal hyperabsorption of calcium and is a frequent cause of calcium oxalate nephrolithiasis. Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adenylyl cyclase; Nucleotide Metabolism - purine; Lyase; EC 4.6.1.1

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: growth cone; cytoskeleton; cell soma; perinuclear region of cytoplasm; apical part of cell; axon; dendrite; cytoplasm; plasma membrane; cytosol

Molecular Function: manganese ion binding; magnesium ion binding; ATPase binding; ATP binding; adenylate cyclase activity

Biological Process: positive regulation of apoptosis; cAMP biosynthetic process; spermatogenesis

Disease: Hypercalciuria, Absorptive, 2

Similar Products

Product Notes

The ADCY10 adcy10 (Catalog #AAA3208582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADCY10 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADCY10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADCY10 adcy10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTAMTEKFSS AMYMDRGAEQ LVEILNYHIS AIVEKVLIFG GDILKFAGDA. It is sometimes possible for the material contained within the vial of "ADCY10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.