Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ADCK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Membrane in bile canaliculi, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: donkey anti-rabbit FITCSecondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit anti-Human ADCK2 Polyclonal Antibody | anti-ADCK2 antibody

ADCK2 Antibody - middle region

Gene Names
ADCK2; AARF
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ADCK2; Polyclonal Antibody; ADCK2 Antibody - middle region; anti-ADCK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
Sequence Length
626
Applicable Applications for anti-ADCK2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ADCK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Membrane in bile canaliculi, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: donkey anti-rabbit FITCSecondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC) (Rabbit Anti-ADCK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Membrane in bile canaliculi, strong signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: donkey anti-rabbit FITCSecondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(Host: RabbitTarget Name: ADCK2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: ADCK2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-ADCK2 antibody
This is a rabbit polyclonal antibody against ADCK2. It was validated on Western Blot

Target Description: The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
Product Categories/Family for anti-ADCK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
uncharacterized aarF domain-containing protein kinase 2
NCBI Official Synonym Full Names
aarF domain containing kinase 2
NCBI Official Symbol
ADCK2
NCBI Official Synonym Symbols
AARF
NCBI Protein Information
uncharacterized aarF domain-containing protein kinase 2
UniProt Protein Name
Uncharacterized aarF domain-containing protein kinase 2
UniProt Gene Name
ADCK2
UniProt Synonym Gene Names
AARF
UniProt Entry Name
ADCK2_HUMAN

Uniprot Description

ADCK2: The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr). Belongs to the protein kinase superfamily. ADCK protein kinase family.

Protein type: Kinase, protein; Protein kinase, atypical; Protein kinase, Ser/Thr (non-receptor); EC 2.7.-.-; EC 2.7.11.-; Membrane protein, integral; ATYPICAL group; ABC1 family; ABC1-C subfamily

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: mitochondrion; integral to membrane

Molecular Function: protein serine/threonine kinase activity; ATP binding

Biological Process: protein amino acid phosphorylation

Research Articles on ADCK2

Similar Products

Product Notes

The ADCK2 adck2 (Catalog #AAA3215898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADCK2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADCK2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ADCK2 adck2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGNGRKPPEN LADQSFLERL LLPKADLVGS NAGVSRAQVP GHQPEATNLI. It is sometimes possible for the material contained within the vial of "ADCK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.