Mouse anti-Human ADAT3 Polyclonal Antibody | anti-Adat3 antibody

ADAT3 (LOC113179, Probable Inactive tRNA-specific Adenosine Deaminase-like Protein 3, tRNA-specific Adenosine-34 Deaminase Subunit ADAT3, FWP005, MST121, MSTP121, S863-5, TAD3)

Cat. Num. AAA6005658

• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ADAT3; Polyclonal Antibody; ADAT3 (LOC113179; Probable Inactive tRNA-specific Adenosine Deaminase-like Protein 3; tRNA-specific Adenosine-34 Deaminase Subunit ADAT3; FWP005; MST121; MSTP121; S863-5; TAD3); Anti -ADAT3 (LOC113179; anti-Adat3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human LOC113179.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT

• Applicable Applications for anti-Adat3 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human LOC113179, aa1-351 (NP_612431).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LOC113179 expression in transfected 293T cell line by LOC113179 polyclonal antibody. Lane 1: LOC113179 transfected lysate (38.61kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-Adat3 antibody

ADAT3 may be involved in deamination of adenosine-34 to inosine in many tRNAs as a regulatory subunit (Potential).

Product Categories/Family for anti-Adat3 antibody

Antibodies; Abs to Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 62531223
• NCBI GeneID: 100125374
• UniProt Accession #: Q561R2
• Molecular Weight: 37,704 Da
• NCBI Official Full Name: Adat3 protein
• NCBI Official Synonym Full Names: adenosine deaminase, tRNA-specific 3
• NCBI Official Symbol: Adat3
• NCBI Protein Information: probable inactive tRNA-specific adenosine deaminase-like protein 3; adenosine deaminase, tRNA-specific 3, TAD3 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT3
• UniProt Protein Name: Probable inactive tRNA-specific adenosine deaminase-like protein 3
• Protein Family: Probable inactive tRNA-specific adenosine deaminase-like protein
• UniProt Gene Name: Adat3
• UniProt Entry Name: ADAT3_RAT

Uniprot Description

ADAT3: May be involved in deamination of adenosine-34 to inosine in many tRNAs as a regulatory subunit (Potential). Belongs to the cytidine and deoxycytidylate deaminase family. ADAT3 subfamily.

Protein type: Hydrolase; RNA processing

Molecular Function: hydrolase activity; zinc ion binding

Biological Process: tRNA processing