Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ADARB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Rabbit ADARB1 Polyclonal Antibody | anti-ADARB1 antibody

ADARB1 Rabbit pAb

Gene Names
ADARB1; RED1; ADAR2; DRABA2; DRADA2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ADARB1; Polyclonal Antibody; ADARB1 Rabbit pAb; ADAR2; DRABA2; DRADA2; RED1; anti-ADARB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
FETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCING
Applicable Applications for anti-ADARB1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 180-380 of human ADARB1 (NP_001103.1).
Positive Samples
U-251MG, HeLa, Jurkat, HepG2, mouse brain, mouse lung, mouse testis, rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ADARB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ADARB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-ADARB1 antibody
Background: This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
104
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
80,763 Da
NCBI Official Full Name
double-stranded RNA-specific editase 1 isoform 1
NCBI Official Synonym Full Names
adenosine deaminase, RNA-specific, B1
NCBI Official Symbol
ADARB1
NCBI Official Synonym Symbols
RED1; ADAR2; DRABA2; DRADA2
NCBI Protein Information
double-stranded RNA-specific editase 1; RNA editase; RED1 homolog; RNA-editing enzyme 1; RNA editing deaminase 1; RNA-editing deaminase 1; dsRNA adenosine deaminase DRADA2; adenosine deaminase, RNA-specific, B1 (RED1 homolog rat); adenosine deaminase, RNA
UniProt Protein Name
Double-stranded RNA-specific editase 1
UniProt Gene Name
ADARB1
UniProt Synonym Gene Names
ADAR2; DRADA2; RED1
UniProt Entry Name
RED1_HUMAN

NCBI Description

This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008]

Uniprot Description

RED1: Editing of the messenger RNAs for glutamate receptor (GluR) subunits by site-selective adenosine deamination. Edits both the GluR-B Q/R and R/G sites efficiently but converts the adenosine in hotspot1 much less efficiently. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Nucleolus; Hydrolase; EC 3.5.4.37

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: adenosine deaminase activity; mRNA binding; double-stranded RNA adenosine deaminase activity; protein binding; RNA binding; metal ion binding; double-stranded RNA binding

Biological Process: RNA processing; negative regulation of cell proliferation; base conversion or substitution editing; positive regulation of viral genome replication; regulation of cell cycle; mRNA modification; innate immune response; gene expression; mRNA processing; defense response to virus; adenosine to inosine editing; negative regulation of cell migration

Research Articles on ADARB1

Similar Products

Product Notes

The ADARB1 adarb1 (Catalog #AAA9142438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADARB1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADARB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ADARB1 adarb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FETPDKAEPP FYVGSNGDDS FSSSGDLSLS ASPVPASLAQ PPLPVLPPFP PPSGKNPVMI LNELRPGLKY DFLSESGESH AKSFVMSVVV DGQFFEGSGR NKKLAKARAA QSALAAIFNL HLDQTPSRQP IPSEGLQLHL PQVLADAVSR LVLGKFGDLT DNFSSPHARR KVLAGVVMTT GTDVKDAKVI SVSTGTKCIN G. It is sometimes possible for the material contained within the vial of "ADARB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.