Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADAMTS19 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit ADAMTS19 Polyclonal Antibody | anti-ADAMTS19 antibody

ADAMTS19 antibody - N-terminal region

Reactivity
Cow, Dog, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADAMTS19; Polyclonal Antibody; ADAMTS19 antibody - N-terminal region; anti-ADAMTS19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP
Sequence Length
1207
Applicable Applications for anti-ADAMTS19 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Human: 100%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADAMTS19 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-ADAMTS19 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-ADAMTS19 antibody
This is a rabbit polyclonal antibody against ADAMTS19. It was validated on Western Blot

Target Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.
Product Categories/Family for anti-ADAMTS19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100kDa
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 19
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif 19
NCBI Official Symbol
ADAMTS19
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 19
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 19
UniProt Gene Name
ADAMTS19
UniProt Synonym Gene Names
ADAM-TS 19; ADAM-TS19; ADAMTS-19
UniProt Entry Name
ATS19_HUMAN

NCBI Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member. [provided by RefSeq, Jul 2008]

Uniprot Description

ADAMTS19:

Protein type: Extracellular matrix; Motility/polarity/chemotaxis; EC 3.4.24.-; Secreted; Secreted, signal peptide; Protease

Chromosomal Location of Human Ortholog: 5q23.3

Cellular Component: proteinaceous extracellular matrix

Molecular Function: zinc ion binding; metalloendopeptidase activity

Biological Process: proteolysis

Research Articles on ADAMTS19

Similar Products

Product Notes

The ADAMTS19 adamts19 (Catalog #AAA3204851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAMTS19 antibody - N-terminal region reacts with Cow, Dog, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADAMTS19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAMTS19 adamts19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRLTHICCCC LLYQLGFLSN GIVSELQFAP DREEWEVVFP ALWRREPVDP. It is sometimes possible for the material contained within the vial of "ADAMTS19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.