Western Blot (WB)
(WB Suggested Anti-ADAM7 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Rabbit ADAM7 Polyclonal Antibody | anti-ADAM7 antibody
ADAM7 antibody - C-terminal region
Gene Names
ADAM7; EAPI; GP83; GP-83; ADAM 7; ADAM-7
Reactivity
Dog, Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADAM7; Polyclonal Antibody; ADAM7 antibody - C-terminal region; anti-ADAM7 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
Sequence Length
754
Applicable Applications for anti-ADAM7 antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 85%; Human: 100%; Mouse: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADAM7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ADAM7 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-ADAM7 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-ADAM7 antibody
This is a rabbit polyclonal antibody against ADAM7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 DB077360.1 5-34 31-396 AF215824.1 2-367 397-692 BC058037.1 466-761 693-1666 AF215824.1 664-1637 1667-2321 BC043207.2 1000-1654 2322-2612 AF215824.1 2293-2583
Target Description: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 DB077360.1 5-34 31-396 AF215824.1 2-367 397-692 BC058037.1 466-761 693-1666 AF215824.1 664-1637 1667-2321 BC043207.2 1000-1654 2322-2612 AF215824.1 2293-2583
Product Categories/Family for anti-ADAM7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 7 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 7
NCBI Official Symbol
ADAM7
NCBI Official Synonym Symbols
EAPI; GP83; GP-83; ADAM 7; ADAM-7
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 7
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 7
Protein Family
UniProt Gene Name
ADAM7
UniProt Synonym Gene Names
GP83; ADAM 7
NCBI Description
This gene encodes a member of the ADAMs family of zinc proteases. These transmembrane proteins play roles in multiple processes including cell signaling, adhesion and migration. The encoded protein lacks protease activity and may play roles in protein-protein interactions and cell adhesion processes including sperm-egg fusion. Mutations in this gene may be involved in the progression of melanoma. [provided by RefSeq, Oct 2011]
Uniprot Description
May play an important role in male reproduction including sperm maturation and gonadotrope function. This is a non catalytic metalloprotease-like protein ().
Research Articles on ADAM7
Similar Products
Product Notes
The ADAM7 adam7 (Catalog #AAA3211407) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAM7 antibody - C-terminal region reacts with Dog, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAM7 adam7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTETLGVENK GYFGDEQQIR TEPILPEIHF LNKPASKDSR GIADPNQSAK. It is sometimes possible for the material contained within the vial of "ADAM7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
