Mouse anti-Human ADAM30 Monoclonal Antibody | anti-ADAM30 antibody

ADAM30 (Disintegrin And Metalloproteinase Domain-containing Protein 30, ADAM 30, UNQ2509/PRO5997, svph4) (Biotin)

Cat. Num. AAA6140485

• Gene Names: ADAM30; svph4
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADAM30; Monoclonal Antibody; ADAM30 (Disintegrin And Metalloproteinase Domain-containing Protein 30; ADAM 30; UNQ2509/PRO5997; svph4) (Biotin); anti-ADAM30 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E5
• Specificity: Recognizes human ADAM30.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ADAM30 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa199-299 from human ADAM30 (NP_068566) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ADAM30 is 1ng/ml as a capture antibody.)

Related Product Information for anti-ADAM30 antibody

ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.

Product Categories/Family for anti-ADAM30 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 31881770
• NCBI GeneID: 11085
• NCBI Accession #: NP_068566
• NCBI GenBank Nucleotide #: NM_021794
• UniProt Accession #: Q9UKF2
• Molecular Weight: 66kDa
• NCBI Official Full Name: disintegrin and metalloproteinase domain-containing protein 30 preproprotein
• NCBI Official Synonym Full Names: ADAM metallopeptidase domain 30
• NCBI Official Symbol: ADAM30
• NCBI Official Synonym Symbols: svph4
• NCBI Protein Information: disintegrin and metalloproteinase domain-containing protein 30
• UniProt Protein Name: Disintegrin and metalloproteinase domain-containing protein 30
• Protein Family: Disintegrin and metalloproteinase domain-containing protein
• UniProt Gene Name: ADAM30
• UniProt Synonym Gene Names: ADAM 30
• UniProt Entry Name: ADA30_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. [provided by RefSeq, Jul 2008]